data_2CJC # _entry.id 2CJC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2CJC PDBE EBI-28369 WWPDB D_1290028369 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1MOG unspecified 'CRYSTAL STRUCTURE OF H. SALINARUM DODECIN' PDB 2CC6 unspecified 'COMPLEXES OF DODECIN WITH FLAVIN AND FLAVIN -LIKE LIGANDS' PDB 2CC7 unspecified 'COMPLEXES OF DODECIN WITH FLAVIN AND FLAVIN -LIKE LIGANDS' PDB 2CC8 unspecified 'COMPLEXES OF DODECIN WITH FLAVIN AND FLAVIN -LIKE LIGANDS' PDB 2CC9 unspecified 'COMPLEXES OF DODECIN WITH FLAVIN AND FLAVIN -LIKE LIGANDS' PDB 2CCB unspecified 'COMPLEXES OF DODECIN WITH FLAVIN AND FLAVIN -LIKE LIGANDS' PDB 2CCC unspecified 'COMPLEXES OF DODECIN WITH FLAVIN AND FLAVIN -LIKE LIGANDS' PDB 2CIE unspecified 'COMPLEXES OF DODECIN WITH FLAVIN AND FLAVIN -LIKE LIGANDS' PDB 2CIF unspecified 'COMPLEXES OF DODECIN WITH FLAVIN AND FLAVIN -LIKE LIGANDS' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CJC _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2006-03-31 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Grininger, M.' 1 'Seiler, F.' 2 'Zeth, K.' 3 'Oesterhelt, D.' 4 # _citation.id primary _citation.title 'Dodecin Sequesters Fad in Closed Conformation from the Aqueous Solution.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 364 _citation.page_first 561 _citation.page_last ? _citation.year 2006 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17027852 _citation.pdbx_database_id_DOI 10.1016/J.JMB.2006.08.083 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Grininger, M.' 1 primary 'Seiler, F.' 2 primary 'Zeth, K.' 3 primary 'Oesterhelt, D.' 4 # _cell.entry_id 2CJC _cell.length_a 142.040 _cell.length_b 142.040 _cell.length_c 142.040 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 96 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2CJC _symmetry.space_group_name_H-M 'F 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 210 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man VNG1446H 7442.059 1 ? ? ? 'FAD BOUND' 2 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 6 non-polymer syn 'FLAVIN-ADENINE DINUCLEOTIDE' 785.550 1 ? ? ? ? 7 water nat water 18.015 69 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name DODECIN # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MVFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVEIGAVEERTYQTEVQVAFELDGSQ _entity_poly.pdbx_seq_one_letter_code_can MVFKKVLLTGTSEESFTAAADDAIDRAEDTLDNVVWAEVVDQGVEIGAVEERTYQTEVQVAFELDGSQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 PHE n 1 4 LYS n 1 5 LYS n 1 6 VAL n 1 7 LEU n 1 8 LEU n 1 9 THR n 1 10 GLY n 1 11 THR n 1 12 SER n 1 13 GLU n 1 14 GLU n 1 15 SER n 1 16 PHE n 1 17 THR n 1 18 ALA n 1 19 ALA n 1 20 ALA n 1 21 ASP n 1 22 ASP n 1 23 ALA n 1 24 ILE n 1 25 ASP n 1 26 ARG n 1 27 ALA n 1 28 GLU n 1 29 ASP n 1 30 THR n 1 31 LEU n 1 32 ASP n 1 33 ASN n 1 34 VAL n 1 35 VAL n 1 36 TRP n 1 37 ALA n 1 38 GLU n 1 39 VAL n 1 40 VAL n 1 41 ASP n 1 42 GLN n 1 43 GLY n 1 44 VAL n 1 45 GLU n 1 46 ILE n 1 47 GLY n 1 48 ALA n 1 49 VAL n 1 50 GLU n 1 51 GLU n 1 52 ARG n 1 53 THR n 1 54 TYR n 1 55 GLN n 1 56 THR n 1 57 GLU n 1 58 VAL n 1 59 GLN n 1 60 VAL n 1 61 ALA n 1 62 PHE n 1 63 GLU n 1 64 LEU n 1 65 ASP n 1 66 GLY n 1 67 SER n 1 68 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain R1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HALOBACTERIUM SALINARIUM' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2242 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET22B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'GERMAN COLLECTION OF MICROORGANISMS (DSM 671)' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9HPW4_HALSA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q9HPW4 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CJC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HPW4 _struct_ref_seq.db_align_beg 10 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 77 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 68 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 FAD non-polymer . 'FLAVIN-ADENINE DINUCLEOTIDE' ? 'C27 H33 N9 O15 P2' 785.550 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2CJC _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.01 _exptl_crystal.density_percent_sol 69.34 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.50 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.2 M MGCL2, 2.0 M NACL, 0.1 M NA HEPES PH 7.5 AND 30% PEG400' # _diffrn.id 1 _diffrn.ambient_temp 293.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2004-04-12 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0056 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.pdbx_synchrotron_site SLS _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_wavelength 1.0056 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2CJC _reflns.observed_criterion_sigma_I 2.500 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.000 _reflns.d_resolution_high 1.850 _reflns.number_obs 10961 _reflns.number_all ? _reflns.percent_possible_obs 99.1 _reflns.pdbx_Rmerge_I_obs 0.09000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 12.6000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 6.800 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.85 _reflns_shell.d_res_low 1.96 _reflns_shell.percent_possible_all 99.8 _reflns_shell.Rmerge_I_obs 0.67000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.670 _reflns_shell.pdbx_redundancy 6.80 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2CJC _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 10330 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 1.85 _refine.ls_percent_reflns_obs 99.3 _refine.ls_R_factor_obs 0.195 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.194 _refine.ls_R_factor_R_free 0.222 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.200 _refine.ls_number_reflns_R_free 568 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.957 _refine.correlation_coeff_Fo_to_Fc_free 0.942 _refine.B_iso_mean 37.03 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. CRYSTALLIZATION OF RECONSTITUTED HOLOCOMPLEX' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.102 _refine.pdbx_overall_ESU_R_Free 0.102 _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 495 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 47 _refine_hist.number_atoms_solvent 69 _refine_hist.number_atoms_total 611 _refine_hist.d_res_high 1.85 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.018 0.022 ? 545 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2.169 2.032 ? 747 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.866 5.000 ? 63 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 38.349 26.667 ? 27 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.520 15.000 ? 81 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 7.103 15.000 ? 2 'X-RAY DIFFRACTION' ? r_chiral_restr 0.118 0.200 ? 86 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.008 0.020 ? 410 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.217 0.200 ? 196 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.312 0.200 ? 368 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.237 0.200 ? 66 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.249 0.200 ? 71 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.195 0.200 ? 20 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.440 1.500 ? 316 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.648 2.000 ? 510 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 3.319 3.000 ? 229 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 5.733 4.500 ? 237 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.85 _refine_ls_shell.d_res_low 1.90 _refine_ls_shell.number_reflns_R_work 753 _refine_ls_shell.R_factor_R_work 0.2950 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.3190 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 43 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2CJC _struct.title 'Complexes of Dodecin with Flavin and Flavin-like Ligands' _struct.pdbx_descriptor VNG1446H _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CJC _struct_keywords.pdbx_keywords FLAVOPROTEIN _struct_keywords.text FLAVOPROTEIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? G N N 6 ? H N N 7 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 15 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 31 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 15 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 31 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B MG . MG ? ? ? 1_555 H HOH . O ? ? A MG 101 A HOH 2054 1_555 ? ? ? ? ? ? ? 2.186 ? metalc2 metalc ? ? B MG . MG ? ? ? 1_555 H HOH . O ? ? A MG 101 A HOH 2029 24_555 ? ? ? ? ? ? ? 2.311 ? metalc3 metalc ? ? B MG . MG ? ? ? 1_555 A GLU 14 OE2 ? ? A MG 101 A GLU 14 1_555 ? ? ? ? ? ? ? 2.251 ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 H HOH . O ? ? A MG 101 A HOH 2018 1_555 ? ? ? ? ? ? ? 2.162 ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 H HOH . O ? ? A MG 101 A HOH 2023 24_555 ? ? ? ? ? ? ? 2.196 ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 H HOH . O ? ? A MG 101 A HOH 2024 24_555 ? ? ? ? ? ? ? 2.103 ? metalc7 metalc ? ? C MG . MG ? ? ? 1_555 A ASP 41 OD2 ? ? A MG 102 A ASP 41 80_555 ? ? ? ? ? ? ? 2.230 ? metalc8 metalc ? ? C MG . MG ? ? ? 1_555 H HOH . O ? ? A MG 102 A HOH 2046 80_555 ? ? ? ? ? ? ? 2.303 ? metalc9 metalc ? ? C MG . MG ? ? ? 1_555 H HOH . O ? ? A MG 102 A HOH 2069 75_555 ? ? ? ? ? ? ? 2.686 ? metalc10 metalc ? ? D NA . NA ? ? ? 1_555 H HOH . O ? ? A NA 103 A HOH 2063 80_555 ? ? ? ? ? ? ? 2.302 ? metalc11 metalc ? ? D NA . NA ? ? ? 1_555 E CL . CL ? ? A NA 103 A CL 105 1_555 ? ? ? ? ? ? ? 2.514 ? metalc12 metalc ? ? D NA . NA ? ? ? 1_555 E CL . CL ? ? A NA 103 A CL 105 59_555 ? ? ? ? ? ? ? 2.514 ? metalc13 metalc ? ? D NA . NA ? ? ? 1_555 E CL . CL ? ? A NA 103 A CL 105 80_555 ? ? ? ? ? ? ? 2.514 ? metalc14 metalc ? ? D NA . NA ? ? ? 1_555 H HOH . O ? ? A NA 103 A HOH 2063 1_555 ? ? ? ? ? ? ? 2.293 ? metalc15 metalc ? ? D NA . NA ? ? ? 1_555 H HOH . O ? ? A NA 103 A HOH 2063 59_555 ? ? ? ? ? ? ? 2.304 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 PHE A 3 ? SER A 12 ? PHE A 3 SER A 12 AA 2 THR A 53 ? GLU A 63 ? THR A 53 GLU A 63 AA 3 VAL A 34 ? GLU A 45 ? VAL A 34 GLU A 45 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N SER A 12 ? N SER A 12 O TYR A 54 ? O TYR A 54 AA 2 3 O ALA A 61 ? O ALA A 61 N VAL A 35 ? N VAL A 35 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 101' AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG A 102' AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 103' AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 105' AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 300' AC6 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE FAD A1066' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 14 ? GLU A 14 . ? 1_555 ? 2 AC1 6 HOH H . ? HOH A 2018 . ? 1_555 ? 3 AC1 6 HOH H . ? HOH A 2023 . ? 1_555 ? 4 AC1 6 HOH H . ? HOH A 2024 . ? 1_555 ? 5 AC1 6 HOH H . ? HOH A 2029 . ? 1_555 ? 6 AC1 6 HOH H . ? HOH A 2054 . ? 1_555 ? 7 AC2 3 ASP A 41 ? ASP A 41 . ? 1_555 ? 8 AC2 3 HOH H . ? HOH A 2046 . ? 1_555 ? 9 AC2 3 HOH H . ? HOH A 2069 . ? 1_555 ? 10 AC3 3 CL E . ? CL A 105 . ? 1_555 ? 11 AC3 3 HOH H . ? HOH A 2006 . ? 1_555 ? 12 AC3 3 HOH H . ? HOH A 2063 . ? 1_555 ? 13 AC4 2 GLN A 59 ? GLN A 59 . ? 1_555 ? 14 AC4 2 NA D . ? NA A 103 . ? 1_555 ? 15 AC5 3 SER A 15 ? SER A 15 . ? 1_555 ? 16 AC5 3 THR A 17 ? THR A 17 . ? 1_555 ? 17 AC5 3 HOH H . ? HOH A 2068 . ? 1_555 ? 18 AC6 8 VAL A 35 ? VAL A 35 . ? 1_555 ? 19 AC6 8 TRP A 36 ? TRP A 36 . ? 1_555 ? 20 AC6 8 GLU A 38 ? GLU A 38 . ? 1_555 ? 21 AC6 8 VAL A 44 ? VAL A 44 . ? 1_555 ? 22 AC6 8 GLU A 45 ? GLU A 45 . ? 1_555 ? 23 AC6 8 ALA A 48 ? ALA A 48 . ? 1_555 ? 24 AC6 8 GLN A 55 ? GLN A 55 . ? 1_555 ? 25 AC6 8 HOH H . ? HOH A 2069 . ? 1_555 ? # _database_PDB_matrix.entry_id 2CJC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CJC _atom_sites.fract_transf_matrix[1][1] 0.007040 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007040 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007040 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL MG N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLY 66 66 ? ? ? A . n A 1 67 SER 67 67 ? ? ? A . n A 1 68 GLN 68 68 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 101 101 MG MG A . C 2 MG 1 102 102 MG MG A . D 3 NA 1 103 103 NA NA A . E 4 CL 1 105 105 CL CL A . F 5 SO4 1 300 300 SO4 SO4 A . G 6 FAD 1 1066 1066 FAD FAD A . H 7 HOH 1 2001 2001 HOH HOH A . H 7 HOH 2 2002 2002 HOH HOH A . H 7 HOH 3 2003 2003 HOH HOH A . H 7 HOH 4 2004 2004 HOH HOH A . H 7 HOH 5 2005 2005 HOH HOH A . H 7 HOH 6 2006 2006 HOH HOH A . H 7 HOH 7 2007 2007 HOH HOH A . H 7 HOH 8 2008 2008 HOH HOH A . H 7 HOH 9 2009 2009 HOH HOH A . H 7 HOH 10 2010 2010 HOH HOH A . H 7 HOH 11 2011 2011 HOH HOH A . H 7 HOH 12 2012 2012 HOH HOH A . H 7 HOH 13 2013 2013 HOH HOH A . H 7 HOH 14 2014 2014 HOH HOH A . H 7 HOH 15 2015 2015 HOH HOH A . H 7 HOH 16 2016 2016 HOH HOH A . H 7 HOH 17 2017 2017 HOH HOH A . H 7 HOH 18 2018 2018 HOH HOH A . H 7 HOH 19 2019 2019 HOH HOH A . H 7 HOH 20 2020 2020 HOH HOH A . H 7 HOH 21 2021 2021 HOH HOH A . H 7 HOH 22 2022 2022 HOH HOH A . H 7 HOH 23 2023 2023 HOH HOH A . H 7 HOH 24 2024 2024 HOH HOH A . H 7 HOH 25 2025 2025 HOH HOH A . H 7 HOH 26 2026 2026 HOH HOH A . H 7 HOH 27 2027 2027 HOH HOH A . H 7 HOH 28 2028 2028 HOH HOH A . H 7 HOH 29 2029 2029 HOH HOH A . H 7 HOH 30 2030 2030 HOH HOH A . H 7 HOH 31 2031 2031 HOH HOH A . H 7 HOH 32 2032 2032 HOH HOH A . H 7 HOH 33 2033 2033 HOH HOH A . H 7 HOH 34 2034 2034 HOH HOH A . H 7 HOH 35 2035 2035 HOH HOH A . H 7 HOH 36 2036 2036 HOH HOH A . H 7 HOH 37 2037 2037 HOH HOH A . H 7 HOH 38 2038 2038 HOH HOH A . H 7 HOH 39 2039 2039 HOH HOH A . H 7 HOH 40 2040 2040 HOH HOH A . H 7 HOH 41 2041 2041 HOH HOH A . H 7 HOH 42 2042 2042 HOH HOH A . H 7 HOH 43 2043 2043 HOH HOH A . H 7 HOH 44 2044 2044 HOH HOH A . H 7 HOH 45 2045 2045 HOH HOH A . H 7 HOH 46 2046 2046 HOH HOH A . H 7 HOH 47 2047 2047 HOH HOH A . H 7 HOH 48 2048 2048 HOH HOH A . H 7 HOH 49 2049 2049 HOH HOH A . H 7 HOH 50 2050 2050 HOH HOH A . H 7 HOH 51 2051 2051 HOH HOH A . H 7 HOH 52 2052 2052 HOH HOH A . H 7 HOH 53 2053 2053 HOH HOH A . H 7 HOH 54 2054 2054 HOH HOH A . H 7 HOH 55 2055 2055 HOH HOH A . H 7 HOH 56 2056 2056 HOH HOH A . H 7 HOH 57 2057 2057 HOH HOH A . H 7 HOH 58 2058 2058 HOH HOH A . H 7 HOH 59 2059 2059 HOH HOH A . H 7 HOH 60 2060 2060 HOH HOH A . H 7 HOH 61 2061 2061 HOH HOH A . H 7 HOH 62 2062 2062 HOH HOH A . H 7 HOH 63 2063 2063 HOH HOH A . H 7 HOH 64 2064 2064 HOH HOH A . H 7 HOH 65 2065 2065 HOH HOH A . H 7 HOH 66 2066 2066 HOH HOH A . H 7 HOH 67 2067 2067 HOH HOH A . H 7 HOH 68 2068 2068 HOH HOH A . H 7 HOH 69 2069 2069 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details dodecameric _pdbx_struct_assembly.oligomeric_count 12 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 4 'crystal symmetry operation' 80_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 5 'crystal symmetry operation' 59_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 82_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 52_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 8 'crystal symmetry operation' 75_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 9 'crystal symmetry operation' 54_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 36_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 31_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 26_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A NA 103 ? D NA . 2 1 A CL 105 ? E CL . 3 1 A SO4 300 ? F SO4 . 4 1 A SO4 300 ? F SO4 . 5 1 A HOH 2006 ? H HOH . 6 1 A HOH 2049 ? H HOH . 7 1 A HOH 2068 ? H HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? H HOH . ? A HOH 2054 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O ? H HOH . ? A HOH 2029 ? 24_555 92.0 ? 2 O ? H HOH . ? A HOH 2054 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 OE2 ? A GLU 14 ? A GLU 14 ? 1_555 89.1 ? 3 O ? H HOH . ? A HOH 2029 ? 24_555 MG ? B MG . ? A MG 101 ? 1_555 OE2 ? A GLU 14 ? A GLU 14 ? 1_555 173.6 ? 4 O ? H HOH . ? A HOH 2054 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O ? H HOH . ? A HOH 2018 ? 1_555 85.8 ? 5 O ? H HOH . ? A HOH 2029 ? 24_555 MG ? B MG . ? A MG 101 ? 1_555 O ? H HOH . ? A HOH 2018 ? 1_555 84.8 ? 6 OE2 ? A GLU 14 ? A GLU 14 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O ? H HOH . ? A HOH 2018 ? 1_555 89.0 ? 7 O ? H HOH . ? A HOH 2054 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O ? H HOH . ? A HOH 2023 ? 24_555 171.3 ? 8 O ? H HOH . ? A HOH 2029 ? 24_555 MG ? B MG . ? A MG 101 ? 1_555 O ? H HOH . ? A HOH 2023 ? 24_555 94.9 ? 9 OE2 ? A GLU 14 ? A GLU 14 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O ? H HOH . ? A HOH 2023 ? 24_555 83.4 ? 10 O ? H HOH . ? A HOH 2018 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O ? H HOH . ? A HOH 2023 ? 24_555 89.6 ? 11 O ? H HOH . ? A HOH 2054 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O ? H HOH . ? A HOH 2024 ? 24_555 84.9 ? 12 O ? H HOH . ? A HOH 2029 ? 24_555 MG ? B MG . ? A MG 101 ? 1_555 O ? H HOH . ? A HOH 2024 ? 24_555 95.8 ? 13 OE2 ? A GLU 14 ? A GLU 14 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O ? H HOH . ? A HOH 2024 ? 24_555 90.5 ? 14 O ? H HOH . ? A HOH 2018 ? 1_555 MG ? B MG . ? A MG 101 ? 1_555 O ? H HOH . ? A HOH 2024 ? 24_555 170.6 ? 15 O ? H HOH . ? A HOH 2023 ? 24_555 MG ? B MG . ? A MG 101 ? 1_555 O ? H HOH . ? A HOH 2024 ? 24_555 99.6 ? 16 OD2 ? A ASP 41 ? A ASP 41 ? 80_555 MG ? C MG . ? A MG 102 ? 1_555 O ? H HOH . ? A HOH 2046 ? 80_555 82.7 ? 17 OD2 ? A ASP 41 ? A ASP 41 ? 80_555 MG ? C MG . ? A MG 102 ? 1_555 O ? H HOH . ? A HOH 2069 ? 75_555 165.4 ? 18 O ? H HOH . ? A HOH 2046 ? 80_555 MG ? C MG . ? A MG 102 ? 1_555 O ? H HOH . ? A HOH 2069 ? 75_555 82.9 ? 19 O ? H HOH . ? A HOH 2063 ? 80_555 NA ? D NA . ? A NA 103 ? 1_555 CL ? E CL . ? A CL 105 ? 1_555 96.7 ? 20 O ? H HOH . ? A HOH 2063 ? 80_555 NA ? D NA . ? A NA 103 ? 1_555 CL ? E CL . ? A CL 105 ? 59_555 96.2 ? 21 CL ? E CL . ? A CL 105 ? 1_555 NA ? D NA . ? A NA 103 ? 1_555 CL ? E CL . ? A CL 105 ? 59_555 0.5 ? 22 O ? H HOH . ? A HOH 2063 ? 80_555 NA ? D NA . ? A NA 103 ? 1_555 CL ? E CL . ? A CL 105 ? 80_555 96.5 ? 23 CL ? E CL . ? A CL 105 ? 1_555 NA ? D NA . ? A NA 103 ? 1_555 CL ? E CL . ? A CL 105 ? 80_555 0.5 ? 24 CL ? E CL . ? A CL 105 ? 59_555 NA ? D NA . ? A NA 103 ? 1_555 CL ? E CL . ? A CL 105 ? 80_555 0.5 ? 25 O ? H HOH . ? A HOH 2063 ? 80_555 NA ? D NA . ? A NA 103 ? 1_555 O ? H HOH . ? A HOH 2063 ? 1_555 118.9 ? 26 CL ? E CL . ? A CL 105 ? 1_555 NA ? D NA . ? A NA 103 ? 1_555 O ? H HOH . ? A HOH 2063 ? 1_555 96.7 ? 27 CL ? E CL . ? A CL 105 ? 59_555 NA ? D NA . ? A NA 103 ? 1_555 O ? H HOH . ? A HOH 2063 ? 1_555 97.0 ? 28 CL ? E CL . ? A CL 105 ? 80_555 NA ? D NA . ? A NA 103 ? 1_555 O ? H HOH . ? A HOH 2063 ? 1_555 96.5 ? 29 O ? H HOH . ? A HOH 2063 ? 80_555 NA ? D NA . ? A NA 103 ? 1_555 O ? H HOH . ? A HOH 2063 ? 59_555 118.4 ? 30 CL ? E CL . ? A CL 105 ? 1_555 NA ? D NA . ? A NA 103 ? 1_555 O ? H HOH . ? A HOH 2063 ? 59_555 96.2 ? 31 CL ? E CL . ? A CL 105 ? 59_555 NA ? D NA . ? A NA 103 ? 1_555 O ? H HOH . ? A HOH 2063 ? 59_555 96.4 ? 32 CL ? E CL . ? A CL 105 ? 80_555 NA ? D NA . ? A NA 103 ? 1_555 O ? H HOH . ? A HOH 2063 ? 59_555 96.7 ? 33 O ? H HOH . ? A HOH 2063 ? 1_555 NA ? D NA . ? A NA 103 ? 1_555 O ? H HOH . ? A HOH 2063 ? 59_555 118.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-11 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0005 ? 1 XDS 'data reduction' . ? 2 XSCALE 'data scaling' . ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 N6A A FAD 1066 ? ? O A HOH 2069 ? ? 1.80 2 1 O A HOH 2010 ? ? O A HOH 2019 ? ? 2.10 3 1 O A HOH 2001 ? ? O A HOH 2005 ? ? 2.14 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 A FAD 1066 ? PA ? G FAD 1 PA 2 1 N 1 A FAD 1066 ? O1A ? G FAD 1 O1A 3 1 N 1 A FAD 1066 ? O2A ? G FAD 1 O2A 4 1 N 1 A FAD 1066 ? O5B ? G FAD 1 O5B 5 1 N 1 A FAD 1066 ? C5B ? G FAD 1 C5B 6 1 N 1 A FAD 1066 ? C4B ? G FAD 1 C4B 7 1 N 1 A FAD 1066 ? O4B ? G FAD 1 O4B 8 1 N 1 A FAD 1066 ? C3B ? G FAD 1 C3B 9 1 N 1 A FAD 1066 ? O3B ? G FAD 1 O3B 10 1 N 1 A FAD 1066 ? C2B ? G FAD 1 C2B 11 1 N 1 A FAD 1066 ? O2B ? G FAD 1 O2B 12 1 N 1 A FAD 1066 ? P ? G FAD 1 P 13 1 N 1 A FAD 1066 ? O1P ? G FAD 1 O1P 14 1 N 1 A FAD 1066 ? O2P ? G FAD 1 O2P 15 1 N 1 A FAD 1066 ? O3P ? G FAD 1 O3P # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 66 ? A GLY 66 3 1 Y 1 A SER 67 ? A SER 67 4 1 Y 1 A GLN 68 ? A GLN 68 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'SODIUM ION' NA 4 'CHLORIDE ION' CL 5 'SULFATE ION' SO4 6 'FLAVIN-ADENINE DINUCLEOTIDE' FAD 7 water HOH #