data_2CSZ # _entry.id 2CSZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CSZ pdb_00002csz 10.2210/pdb2csz/pdb RCSB RCSB024588 ? ? WWPDB D_1000024588 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002010026.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CSZ _pdbx_database_status.recvd_initial_deposition_date 2005-05-23 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Miyamoto, K.' 1 'Sato, M.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution Structure of the RING domain of the Synaptotagmin-like protein 4' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Miyamoto, K.' 1 ? primary 'Sato, M.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Synaptotagmin-like protein 4' 8220.309 1 ? ? 'RING domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Exophilin 2, Granuphilin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGLLEIKRKGAKRGSQHYSDRTCARCQESLGRLSPKTNTCRGCNHLVCRDCRIQESNGTWRCKVCSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGLLEIKRKGAKRGSQHYSDRTCARCQESLGRLSPKTNTCRGCNHLVCRDCRIQESNGTWRCKVCSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002010026.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LEU n 1 9 LEU n 1 10 GLU n 1 11 ILE n 1 12 LYS n 1 13 ARG n 1 14 LYS n 1 15 GLY n 1 16 ALA n 1 17 LYS n 1 18 ARG n 1 19 GLY n 1 20 SER n 1 21 GLN n 1 22 HIS n 1 23 TYR n 1 24 SER n 1 25 ASP n 1 26 ARG n 1 27 THR n 1 28 CYS n 1 29 ALA n 1 30 ARG n 1 31 CYS n 1 32 GLN n 1 33 GLU n 1 34 SER n 1 35 LEU n 1 36 GLY n 1 37 ARG n 1 38 LEU n 1 39 SER n 1 40 PRO n 1 41 LYS n 1 42 THR n 1 43 ASN n 1 44 THR n 1 45 CYS n 1 46 ARG n 1 47 GLY n 1 48 CYS n 1 49 ASN n 1 50 HIS n 1 51 LEU n 1 52 VAL n 1 53 CYS n 1 54 ARG n 1 55 ASP n 1 56 CYS n 1 57 ARG n 1 58 ILE n 1 59 GLN n 1 60 GLU n 1 61 SER n 1 62 ASN n 1 63 GLY n 1 64 THR n 1 65 TRP n 1 66 ARG n 1 67 CYS n 1 68 LYS n 1 69 VAL n 1 70 CYS n 1 71 SER n 1 72 GLY n 1 73 PRO n 1 74 SER n 1 75 SER n 1 76 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene SYTL4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041101-16 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SYTL4_HUMAN _struct_ref.pdbx_db_accession Q96C24 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LLEIKRKGAKRGSQHYSDRTCARCQESLGRLSPKTNTCRGCNHLVCRDCRIQESNGTWRCKVC _struct_ref.pdbx_align_begin 43 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CSZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96C24 _struct_ref_seq.db_align_beg 43 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 105 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 70 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CSZ GLY A 1 ? UNP Q96C24 ? ? 'cloning artifact' 1 1 1 2CSZ SER A 2 ? UNP Q96C24 ? ? 'cloning artifact' 2 2 1 2CSZ SER A 3 ? UNP Q96C24 ? ? 'cloning artifact' 3 3 1 2CSZ GLY A 4 ? UNP Q96C24 ? ? 'cloning artifact' 4 4 1 2CSZ SER A 5 ? UNP Q96C24 ? ? 'cloning artifact' 5 5 1 2CSZ SER A 6 ? UNP Q96C24 ? ? 'cloning artifact' 6 6 1 2CSZ GLY A 7 ? UNP Q96C24 ? ? 'cloning artifact' 7 7 1 2CSZ SER A 71 ? UNP Q96C24 ? ? 'cloning artifact' 71 8 1 2CSZ GLY A 72 ? UNP Q96C24 ? ? 'cloning artifact' 72 9 1 2CSZ PRO A 73 ? UNP Q96C24 ? ? 'cloning artifact' 73 10 1 2CSZ SER A 74 ? UNP Q96C24 ? ? 'cloning artifact' 74 11 1 2CSZ SER A 75 ? UNP Q96C24 ? ? 'cloning artifact' 75 12 1 2CSZ GLY A 76 ? UNP Q96C24 ? ? 'cloning artifact' 76 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.37mM RING domain U-13C,15N; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZNCl2; 0.1mM NTA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CSZ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CSZ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CSZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.925 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2CSZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CSZ _struct.title 'Solution Structure of the RING domain of the Synaptotagmin-like protein 4' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CSZ _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;Exophilin 2, Granuphilin, Synaptotagmin-like protein 4, RING domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 68 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 71 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 68 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 71 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 28 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 201 1_555 ? ? ? ? ? ? ? 2.325 ? ? metalc2 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 31 A ZN 201 1_555 ? ? ? ? ? ? ? 2.325 ? ? metalc3 metalc ? ? A CYS 45 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 45 A ZN 401 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc4 metalc ? ? A CYS 48 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 48 A ZN 401 1_555 ? ? ? ? ? ? ? 2.323 ? ? metalc5 metalc ? ? A CYS 53 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 53 A ZN 201 1_555 ? ? ? ? ? ? ? 2.319 ? ? metalc6 metalc ? ? A CYS 56 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 56 A ZN 201 1_555 ? ? ? ? ? ? ? 2.371 ? ? metalc7 metalc ? ? A CYS 67 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 67 A ZN 401 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc8 metalc ? ? A CYS 70 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 70 A ZN 401 1_555 ? ? ? ? ? ? ? 2.351 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 44 ? CYS A 45 ? THR A 44 CYS A 45 A 2 HIS A 50 ? LEU A 51 ? HIS A 50 LEU A 51 B 1 ARG A 57 ? GLN A 59 ? ARG A 57 GLN A 59 B 2 TRP A 65 ? CYS A 67 ? TRP A 65 CYS A 67 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N CYS A 45 ? N CYS A 45 O HIS A 50 ? O HIS A 50 B 1 2 N ILE A 58 ? N ILE A 58 O ARG A 66 ? O ARG A 66 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 28 ? CYS A 28 . ? 1_555 ? 2 AC1 4 CYS A 31 ? CYS A 31 . ? 1_555 ? 3 AC1 4 CYS A 53 ? CYS A 53 . ? 1_555 ? 4 AC1 4 CYS A 56 ? CYS A 56 . ? 1_555 ? 5 AC2 4 CYS A 45 ? CYS A 45 . ? 1_555 ? 6 AC2 4 CYS A 48 ? CYS A 48 . ? 1_555 ? 7 AC2 4 CYS A 67 ? CYS A 67 . ? 1_555 ? 8 AC2 4 CYS A 70 ? CYS A 70 . ? 1_555 ? # _database_PDB_matrix.entry_id 2CSZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CSZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 TRP 65 65 65 TRP TRP A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLY 76 76 76 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 93.1 ? 2 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 53 ? A CYS 53 ? 1_555 118.9 ? 3 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 53 ? A CYS 53 ? 1_555 119.3 ? 4 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 56 ? A CYS 56 ? 1_555 107.3 ? 5 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 56 ? A CYS 56 ? 1_555 111.4 ? 6 SG ? A CYS 53 ? A CYS 53 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 56 ? A CYS 56 ? 1_555 106.2 ? 7 SG ? A CYS 45 ? A CYS 45 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 105.1 ? 8 SG ? A CYS 45 ? A CYS 45 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 67 ? A CYS 67 ? 1_555 115.7 ? 9 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 67 ? A CYS 67 ? 1_555 110.5 ? 10 SG ? A CYS 45 ? A CYS 45 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 70 ? A CYS 70 ? 1_555 115.4 ? 11 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 70 ? A CYS 70 ? 1_555 116.0 ? 12 SG ? A CYS 67 ? A CYS 67 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 70 ? A CYS 70 ? 1_555 94.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-23 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_dist_value' 6 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 4 'Structure model' '_struct_ref_seq_dif.details' 19 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 20 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 21 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 18 ? ? -61.77 90.49 2 1 TYR A 23 ? ? -84.07 38.50 3 1 CYS A 28 ? ? -41.68 159.70 4 1 LEU A 35 ? ? -88.21 33.20 5 1 ASN A 43 ? ? -83.07 39.24 6 1 ASN A 49 ? ? 37.86 40.27 7 1 ASN A 62 ? ? 47.53 25.23 8 2 SER A 20 ? ? 38.56 43.40 9 2 LEU A 35 ? ? -83.94 34.18 10 2 LYS A 41 ? ? -58.69 -71.36 11 2 ASN A 43 ? ? -83.82 44.31 12 2 THR A 64 ? ? -65.60 -175.91 13 2 SER A 74 ? ? -170.63 149.48 14 3 LYS A 14 ? ? -103.98 -67.95 15 3 SER A 24 ? ? -59.11 98.07 16 3 CYS A 28 ? ? -46.24 162.50 17 3 LEU A 35 ? ? -83.40 36.08 18 3 ASN A 43 ? ? -84.13 46.72 19 3 ASN A 49 ? ? 38.36 41.48 20 4 SER A 6 ? ? -124.23 -62.03 21 4 ARG A 18 ? ? -31.19 130.89 22 4 SER A 24 ? ? -37.54 148.53 23 4 ARG A 30 ? ? -131.36 -33.86 24 4 LEU A 35 ? ? -82.30 38.40 25 4 LEU A 38 ? ? -58.92 170.32 26 4 ASN A 43 ? ? -81.14 39.82 27 4 ASN A 49 ? ? 39.33 43.24 28 4 ASN A 62 ? ? -69.56 -175.27 29 5 LYS A 17 ? ? -95.03 56.63 30 5 LEU A 35 ? ? -87.26 34.15 31 5 ASN A 43 ? ? -87.43 47.15 32 5 ASN A 49 ? ? 37.94 41.26 33 6 LEU A 9 ? ? -37.76 153.90 34 6 ARG A 13 ? ? -174.25 146.55 35 6 LYS A 17 ? ? 31.87 51.21 36 6 GLN A 21 ? ? -58.86 172.76 37 6 CYS A 28 ? ? -48.39 162.39 38 6 LEU A 35 ? ? -87.50 34.76 39 6 ASN A 43 ? ? -83.69 46.02 40 6 ASN A 62 ? ? -65.67 -178.67 41 6 PRO A 73 ? ? -69.79 1.58 42 6 SER A 75 ? ? -67.05 98.76 43 7 SER A 24 ? ? -37.79 150.29 44 7 CYS A 28 ? ? -48.30 164.99 45 7 ASN A 43 ? ? -85.45 45.73 46 7 ASN A 49 ? ? 39.33 41.44 47 7 SER A 74 ? ? -33.83 143.95 48 8 SER A 2 ? ? -173.39 141.71 49 8 ALA A 16 ? ? 74.59 36.80 50 8 LEU A 35 ? ? -79.48 44.24 51 8 LEU A 38 ? ? -58.43 -179.94 52 8 ASN A 43 ? ? -94.73 46.08 53 8 ASN A 49 ? ? 36.47 40.87 54 8 ASN A 62 ? ? -85.49 47.50 55 8 CYS A 70 ? ? -73.17 -70.25 56 9 SER A 5 ? ? 71.50 42.31 57 9 LYS A 14 ? ? -98.37 44.87 58 9 LEU A 35 ? ? -83.14 33.43 59 9 LEU A 38 ? ? -55.13 178.98 60 9 ASN A 43 ? ? -82.24 40.56 61 9 ASN A 62 ? ? -83.89 47.10 62 9 SER A 75 ? ? -103.54 41.48 63 10 SER A 5 ? ? -173.17 128.05 64 10 ARG A 18 ? ? -49.59 162.55 65 10 ASP A 25 ? ? -170.23 145.13 66 10 LEU A 35 ? ? -83.34 35.71 67 10 LEU A 38 ? ? -52.02 170.37 68 10 ASN A 43 ? ? -77.59 43.80 69 10 GLN A 59 ? ? -56.26 103.63 70 10 ASN A 62 ? ? -69.50 -174.96 71 10 CYS A 70 ? ? -65.12 -72.71 72 10 SER A 74 ? ? 36.98 43.28 73 11 SER A 20 ? ? -174.16 146.16 74 11 GLN A 32 ? ? 35.43 47.15 75 11 LEU A 35 ? ? -83.38 34.53 76 11 ASN A 43 ? ? -80.29 40.84 77 11 ASN A 62 ? ? 46.20 25.53 78 11 PRO A 73 ? ? -69.70 2.91 79 12 LYS A 17 ? ? 72.48 45.79 80 12 ARG A 18 ? ? -171.78 139.40 81 12 HIS A 22 ? ? -57.19 87.19 82 12 LEU A 35 ? ? -83.24 33.82 83 12 ASN A 43 ? ? -84.14 48.71 84 12 ASN A 49 ? ? 37.78 42.97 85 12 SER A 75 ? ? -161.62 109.21 86 13 ALA A 16 ? ? -37.78 139.47 87 13 ARG A 18 ? ? -57.83 99.75 88 13 HIS A 22 ? ? -80.58 46.60 89 13 CYS A 28 ? ? -43.16 160.41 90 13 LEU A 35 ? ? -84.80 42.13 91 13 ASN A 43 ? ? -84.76 35.99 92 13 ASN A 49 ? ? 33.52 36.73 93 14 GLU A 10 ? ? -171.38 133.38 94 14 LYS A 17 ? ? -46.14 169.12 95 14 HIS A 22 ? ? -45.89 154.64 96 14 TYR A 23 ? ? -84.78 43.90 97 14 LEU A 35 ? ? -84.07 31.91 98 14 ASN A 43 ? ? -86.70 47.18 99 14 ASN A 49 ? ? 38.11 44.46 100 14 CYS A 70 ? ? -57.39 -71.53 101 14 PRO A 73 ? ? -69.76 4.95 102 15 LEU A 9 ? ? -172.84 144.96 103 15 CYS A 28 ? ? -47.88 160.77 104 15 GLN A 32 ? ? 32.49 54.37 105 15 LEU A 35 ? ? -85.95 30.84 106 15 LEU A 38 ? ? -45.18 160.92 107 15 ASN A 43 ? ? -82.55 37.49 108 15 ASN A 49 ? ? 38.51 39.71 109 15 ASN A 62 ? ? -34.17 -74.61 110 16 LYS A 12 ? ? -166.33 115.84 111 16 ARG A 18 ? ? -34.89 139.09 112 16 GLN A 21 ? ? -108.19 74.90 113 16 LEU A 35 ? ? -80.16 39.45 114 16 ASN A 43 ? ? -79.00 42.35 115 16 ASN A 49 ? ? 36.41 42.94 116 16 ASN A 62 ? ? -90.25 35.43 117 16 PRO A 73 ? ? -69.84 96.05 118 17 LYS A 14 ? ? -40.94 -73.95 119 17 ARG A 18 ? ? 44.15 28.08 120 17 SER A 20 ? ? -169.71 118.88 121 17 TYR A 23 ? ? -106.45 44.40 122 17 CYS A 28 ? ? -47.29 156.84 123 17 ASN A 43 ? ? -83.27 36.45 124 18 SER A 2 ? ? -174.89 146.02 125 18 LYS A 12 ? ? -170.58 132.63 126 18 ARG A 13 ? ? -173.56 140.55 127 18 LEU A 35 ? ? -81.84 33.69 128 18 ASN A 43 ? ? -82.26 38.21 129 19 ARG A 13 ? ? -175.78 140.90 130 19 LEU A 35 ? ? -80.93 36.83 131 19 LEU A 38 ? ? -59.40 -178.86 132 19 ASN A 43 ? ? -79.20 43.65 133 19 ASN A 49 ? ? 33.46 40.70 134 19 PRO A 73 ? ? -69.74 5.78 135 20 LEU A 8 ? ? -173.61 144.80 136 20 HIS A 22 ? ? -79.69 44.20 137 20 LEU A 35 ? ? -83.82 31.21 138 20 ASN A 43 ? ? -89.86 49.81 139 20 ASN A 62 ? ? -34.71 -39.25 140 20 PRO A 73 ? ? -69.78 99.60 141 20 SER A 74 ? ? -45.38 161.72 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #