data_2CT1 # _entry.id 2CT1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CT1 pdb_00002ct1 10.2210/pdb2ct1/pdb RCSB RCSB024590 ? ? WWPDB D_1000024590 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001000882.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CT1 _pdbx_database_status.recvd_initial_deposition_date 2005-05-23 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Miyamoto, K.' 1 'Koshiba, S.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution Structure of the zinc finger domain of Transcriptional repressor CTCF protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Miyamoto, K.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Yokoyama, S.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcriptional repressor CTCF' 8502.587 1 ? ? 'zinc finger domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CCCTC-binding factor, CTCFL paralog, 11-zinc finger protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001000882.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ARG n 1 9 THR n 1 10 HIS n 1 11 SER n 1 12 GLY n 1 13 GLU n 1 14 LYS n 1 15 PRO n 1 16 TYR n 1 17 GLU n 1 18 CYS n 1 19 TYR n 1 20 ILE n 1 21 CYS n 1 22 HIS n 1 23 ALA n 1 24 ARG n 1 25 PHE n 1 26 THR n 1 27 GLN n 1 28 SER n 1 29 GLY n 1 30 THR n 1 31 MET n 1 32 LYS n 1 33 MET n 1 34 HIS n 1 35 ILE n 1 36 LEU n 1 37 GLN n 1 38 LYS n 1 39 HIS n 1 40 THR n 1 41 GLU n 1 42 ASN n 1 43 VAL n 1 44 ALA n 1 45 LYS n 1 46 PHE n 1 47 HIS n 1 48 CYS n 1 49 PRO n 1 50 HIS n 1 51 CYS n 1 52 ASP n 1 53 THR n 1 54 VAL n 1 55 ILE n 1 56 ALA n 1 57 ARG n 1 58 LYS n 1 59 SER n 1 60 ASP n 1 61 LEU n 1 62 GLY n 1 63 VAL n 1 64 HIS n 1 65 LEU n 1 66 ARG n 1 67 LYS n 1 68 GLN n 1 69 HIS n 1 70 SER n 1 71 TYR n 1 72 SER n 1 73 GLY n 1 74 PRO n 1 75 SER n 1 76 SER n 1 77 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene Ctcf _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040809-05 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CTCF_HUMAN _struct_ref.pdbx_db_accession P49711 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSY _struct_ref.pdbx_align_begin 399 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CT1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 71 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P49711 _struct_ref_seq.db_align_beg 399 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 462 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 71 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CT1 GLY A 1 ? UNP P49711 ? ? 'cloning artifact' 1 1 1 2CT1 SER A 2 ? UNP P49711 ? ? 'cloning artifact' 2 2 1 2CT1 SER A 3 ? UNP P49711 ? ? 'cloning artifact' 3 3 1 2CT1 GLY A 4 ? UNP P49711 ? ? 'cloning artifact' 4 4 1 2CT1 SER A 5 ? UNP P49711 ? ? 'cloning artifact' 5 5 1 2CT1 SER A 6 ? UNP P49711 ? ? 'cloning artifact' 6 6 1 2CT1 GLY A 7 ? UNP P49711 ? ? 'cloning artifact' 7 7 1 2CT1 SER A 72 ? UNP P49711 ? ? 'cloning artifact' 72 8 1 2CT1 GLY A 73 ? UNP P49711 ? ? 'cloning artifact' 73 9 1 2CT1 PRO A 74 ? UNP P49711 ? ? 'cloning artifact' 74 10 1 2CT1 SER A 75 ? UNP P49711 ? ? 'cloning artifact' 75 11 1 2CT1 SER A 76 ? UNP P49711 ? ? 'cloning artifact' 76 12 1 2CT1 GLY A 77 ? UNP P49711 ? ? 'cloning artifact' 77 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2.46mM zinc finger domain U-13C, 15N; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZnCl2; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CT1 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CT1 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CT1 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.925 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2CT1 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CT1 _struct.title 'Solution Structure of the zinc finger domain of Transcriptional repressor CTCF protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CT1 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;Transcriptional repressor CTCF, CCCTC-binding factor, zinc finger, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transcription ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 28 ? GLN A 37 ? SER A 28 GLN A 37 1 ? 10 HELX_P HELX_P2 2 LYS A 58 ? LYS A 67 ? LYS A 58 LYS A 67 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.347 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc3 metalc ? ? A HIS 34 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 34 A ZN 201 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc4 metalc ? ? A HIS 39 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 39 A ZN 201 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc5 metalc ? ? A CYS 48 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 48 A ZN 401 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc6 metalc ? ? A CYS 51 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 51 A ZN 401 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc7 metalc ? ? A HIS 64 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 64 A ZN 401 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc8 metalc ? ? A HIS 69 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 69 A ZN 401 1_555 ? ? ? ? ? ? ? 2.330 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 16 ? GLU A 17 ? TYR A 16 GLU A 17 A 2 ARG A 24 ? PHE A 25 ? ARG A 24 PHE A 25 B 1 PHE A 46 ? HIS A 47 ? PHE A 46 HIS A 47 B 2 VAL A 54 ? ILE A 55 ? VAL A 54 ILE A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 16 ? N TYR A 16 O PHE A 25 ? O PHE A 25 B 1 2 N PHE A 46 ? N PHE A 46 O ILE A 55 ? O ILE A 55 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 HIS A 34 ? HIS A 34 . ? 1_555 ? 4 AC1 4 HIS A 39 ? HIS A 39 . ? 1_555 ? 5 AC2 4 CYS A 48 ? CYS A 48 . ? 1_555 ? 6 AC2 4 CYS A 51 ? CYS A 51 . ? 1_555 ? 7 AC2 4 HIS A 64 ? HIS A 64 . ? 1_555 ? 8 AC2 4 HIS A 69 ? HIS A 69 . ? 1_555 ? # _database_PDB_matrix.entry_id 2CT1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CT1 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLY 77 77 77 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 111.9 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 117.6 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 86.7 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 106.5 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 115.2 ? 6 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 118.2 ? 7 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 51 ? A CYS 51 ? 1_555 118.3 ? 8 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 64 ? A HIS 64 ? 1_555 91.0 ? 9 SG ? A CYS 51 ? A CYS 51 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 64 ? A HIS 64 ? 1_555 113.9 ? 10 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 69 ? A HIS 69 ? 1_555 104.2 ? 11 SG ? A CYS 51 ? A CYS 51 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 69 ? A HIS 69 ? 1_555 118.3 ? 12 NE2 ? A HIS 64 ? A HIS 64 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 69 ? A HIS 69 ? 1_555 107.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-23 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_ref_seq_dif.details' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX Determination method: author determined ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -169.04 108.00 2 1 PRO A 15 ? ? -69.83 2.86 3 1 HIS A 39 ? ? -118.89 57.80 4 1 ASN A 42 ? ? -85.21 44.28 5 1 PRO A 49 ? ? -69.77 3.04 6 1 HIS A 50 ? ? -116.30 -71.46 7 1 ALA A 56 ? ? -41.00 -76.25 8 1 LYS A 67 ? ? -71.69 -74.60 9 1 PRO A 74 ? ? -69.79 84.97 10 2 SER A 5 ? ? -170.05 149.04 11 2 ARG A 8 ? ? -85.46 41.86 12 2 HIS A 10 ? ? -63.25 85.08 13 2 PRO A 15 ? ? -69.74 3.18 14 2 ALA A 44 ? ? -91.99 -64.94 15 2 PRO A 49 ? ? -69.75 0.64 16 2 HIS A 50 ? ? -118.34 -70.25 17 2 ALA A 56 ? ? -100.17 -75.47 18 2 PRO A 74 ? ? -69.79 2.84 19 2 SER A 75 ? ? 72.50 41.60 20 3 SER A 3 ? ? -34.93 135.87 21 3 ASN A 42 ? ? -79.78 44.05 22 3 PRO A 49 ? ? -69.73 3.73 23 3 HIS A 50 ? ? -118.58 -71.65 24 3 ALA A 56 ? ? -49.24 -75.28 25 3 PRO A 74 ? ? -69.74 -178.80 26 3 SER A 76 ? ? -131.17 -58.10 27 4 SER A 6 ? ? -36.34 128.44 28 4 PRO A 15 ? ? -69.79 0.94 29 4 ASN A 42 ? ? -82.62 44.72 30 4 ALA A 44 ? ? -79.25 -70.55 31 4 PRO A 49 ? ? -69.73 6.59 32 4 HIS A 50 ? ? -122.98 -71.74 33 4 ALA A 56 ? ? -103.54 -73.21 34 5 PRO A 15 ? ? -69.74 3.94 35 5 HIS A 22 ? ? 72.50 30.23 36 5 ASN A 42 ? ? -81.74 39.84 37 5 PRO A 49 ? ? -69.77 2.54 38 5 HIS A 50 ? ? -116.47 -72.01 39 5 ALA A 56 ? ? -44.64 -75.13 40 5 LYS A 67 ? ? -73.13 -71.76 41 5 PRO A 74 ? ? -69.79 94.10 42 6 HIS A 22 ? ? 73.81 30.15 43 6 ASN A 42 ? ? -81.47 41.15 44 6 ALA A 44 ? ? -92.29 -68.37 45 6 PRO A 49 ? ? -69.75 5.25 46 6 HIS A 50 ? ? -124.29 -65.05 47 6 ALA A 56 ? ? -36.79 -72.67 48 6 LYS A 67 ? ? -77.00 -70.57 49 7 GLU A 13 ? ? -35.21 141.56 50 7 PRO A 15 ? ? -69.77 4.86 51 7 HIS A 39 ? ? -114.00 50.03 52 7 VAL A 43 ? ? -170.28 144.57 53 7 PRO A 49 ? ? -69.78 8.63 54 7 HIS A 50 ? ? -124.20 -70.95 55 7 ALA A 56 ? ? -106.61 -75.14 56 7 LYS A 67 ? ? -72.73 -70.10 57 7 SER A 76 ? ? -173.43 117.71 58 8 GLU A 13 ? ? -84.31 33.08 59 8 PRO A 15 ? ? -69.83 0.64 60 8 CYS A 48 ? ? -35.86 133.82 61 8 PRO A 49 ? ? -69.79 5.39 62 8 HIS A 50 ? ? -125.30 -68.94 63 8 ILE A 55 ? ? -118.42 77.22 64 8 ALA A 56 ? ? -28.07 -74.68 65 8 LYS A 67 ? ? -73.36 -73.59 66 9 HIS A 10 ? ? -103.22 42.57 67 9 SER A 11 ? ? -36.34 138.68 68 9 PRO A 15 ? ? -69.76 3.36 69 9 HIS A 22 ? ? 74.94 38.89 70 9 HIS A 39 ? ? -118.77 50.31 71 9 ASN A 42 ? ? -79.54 43.70 72 9 PRO A 49 ? ? -69.76 13.13 73 9 HIS A 50 ? ? -126.17 -72.64 74 9 ALA A 56 ? ? -44.86 -75.61 75 9 SER A 59 ? ? -38.27 -39.08 76 10 PRO A 15 ? ? -69.74 1.84 77 10 PRO A 49 ? ? -69.74 11.50 78 10 HIS A 50 ? ? -124.91 -71.75 79 10 ALA A 56 ? ? -97.81 -73.45 80 10 LYS A 67 ? ? -76.58 -71.48 81 10 PRO A 74 ? ? -69.77 84.66 82 10 SER A 75 ? ? -172.46 133.33 83 11 VAL A 43 ? ? -171.22 147.92 84 11 ALA A 44 ? ? -87.97 -73.57 85 11 PRO A 49 ? ? -69.77 7.42 86 11 HIS A 50 ? ? -129.48 -73.53 87 11 LYS A 67 ? ? -79.19 -71.37 88 11 TYR A 71 ? ? -132.83 -38.75 89 12 PRO A 15 ? ? -69.78 1.21 90 12 HIS A 22 ? ? 74.48 35.57 91 12 ASN A 42 ? ? -80.14 42.61 92 12 ALA A 44 ? ? -85.36 -70.78 93 12 HIS A 50 ? ? -101.72 -64.04 94 12 THR A 53 ? ? -32.45 122.26 95 12 ALA A 56 ? ? -77.49 -76.28 96 12 SER A 59 ? ? -38.26 -34.87 97 12 LEU A 61 ? ? -35.50 -38.77 98 12 LYS A 67 ? ? -76.07 -71.14 99 12 PRO A 74 ? ? -69.77 5.20 100 13 ILE A 20 ? ? -122.10 -57.06 101 13 CYS A 48 ? ? -38.52 132.98 102 13 PRO A 49 ? ? -69.78 1.66 103 13 ILE A 55 ? ? -118.78 76.91 104 13 ALA A 56 ? ? -26.84 -72.57 105 13 PRO A 74 ? ? -69.77 1.49 106 13 SER A 75 ? ? 36.07 41.77 107 14 SER A 3 ? ? -171.67 114.13 108 14 SER A 11 ? ? -77.96 47.53 109 14 HIS A 39 ? ? -117.91 50.48 110 14 ASN A 42 ? ? -78.22 47.77 111 14 VAL A 43 ? ? -173.47 146.12 112 14 PRO A 49 ? ? -69.82 4.47 113 14 HIS A 50 ? ? -117.38 -72.59 114 14 ALA A 56 ? ? -46.53 -74.46 115 14 LYS A 67 ? ? -73.37 -76.11 116 14 SER A 75 ? ? -93.73 45.75 117 15 PRO A 15 ? ? -69.77 0.92 118 15 HIS A 39 ? ? -113.76 50.34 119 15 ASN A 42 ? ? -76.20 47.93 120 15 ALA A 44 ? ? -91.14 -60.39 121 15 ALA A 56 ? ? -37.65 -75.39 122 15 LYS A 67 ? ? -75.85 -75.17 123 15 PRO A 74 ? ? -69.70 -175.90 124 16 PRO A 15 ? ? -69.75 2.65 125 16 ASN A 42 ? ? -82.50 43.05 126 16 ALA A 44 ? ? -94.25 -67.05 127 16 CYS A 48 ? ? -37.81 137.48 128 16 PRO A 49 ? ? -69.78 10.58 129 16 HIS A 50 ? ? -132.06 -67.45 130 16 ALA A 56 ? ? -29.65 -71.68 131 16 LYS A 67 ? ? -73.56 -72.76 132 17 HIS A 10 ? ? -60.14 89.41 133 17 PRO A 15 ? ? -69.75 4.25 134 17 GLU A 17 ? ? -175.05 139.76 135 17 PRO A 49 ? ? -69.77 10.43 136 17 HIS A 50 ? ? -124.45 -71.44 137 17 ALA A 56 ? ? -53.90 -72.80 138 17 SER A 76 ? ? -58.19 109.50 139 18 THR A 9 ? ? -37.60 140.09 140 18 HIS A 10 ? ? -83.64 36.84 141 18 GLU A 13 ? ? 39.94 28.22 142 18 VAL A 43 ? ? -170.10 147.94 143 18 ALA A 44 ? ? -90.26 -68.13 144 18 PRO A 49 ? ? -69.77 7.31 145 18 HIS A 50 ? ? -126.36 -72.38 146 18 ALA A 56 ? ? -43.94 -76.05 147 18 LYS A 67 ? ? -75.55 -74.18 148 19 PRO A 15 ? ? -69.75 2.58 149 19 VAL A 43 ? ? -170.62 146.01 150 19 ALA A 44 ? ? -92.17 -68.06 151 19 HIS A 50 ? ? -92.49 -67.22 152 19 ALA A 56 ? ? -40.53 -75.38 153 19 LYS A 67 ? ? -70.66 -71.83 154 19 SER A 72 ? ? -130.69 -50.44 155 20 HIS A 10 ? ? -167.49 119.27 156 20 GLU A 13 ? ? -117.87 71.33 157 20 PRO A 15 ? ? -69.76 2.97 158 20 HIS A 22 ? ? 74.86 37.96 159 20 PRO A 49 ? ? -69.71 9.82 160 20 HIS A 50 ? ? -123.48 -71.75 161 20 ALA A 56 ? ? -76.68 -70.55 162 20 LYS A 67 ? ? -71.73 -74.01 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #