data_2CUI # _entry.id 2CUI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CUI pdb_00002cui 10.2210/pdb2cui/pdb RCSB RCSB024633 ? ? WWPDB D_1000024633 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso002001012.3 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CUI _pdbx_database_status.recvd_initial_deposition_date 2005-05-26 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ohnishi, S.' 1 'Kigawa, T.' 2 'Tochio, N.' 3 'Koshiba, S.' 4 'Inoue, M.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the 31st fibronectin type III domain of the human tenascin X' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohnishi, S.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Tochio, N.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Inoue, M.' 5 ? primary 'Yokoyama, S.' 6 ? # _cell.entry_id 2CUI _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2CUI _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Tenascin-X _entity.formula_weight 11927.401 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'the 29th fibronectin type III domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TN-X, Hexabrachion-like protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGSRPRLSQLSVTDVTTSSLRLNWEAPPGAFDSFLLRFGVPSPSTLEPHPRPLLQRELMVPGTRHSAVLRDLRSG TLYSLTLYGLRGPHKADSIQGTARTLSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGSRPRLSQLSVTDVTTSSLRLNWEAPPGAFDSFLLRFGVPSPSTLEPHPRPLLQRELMVPGTRHSAVLRDLRSG TLYSLTLYGLRGPHKADSIQGTARTLSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso002001012.3 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 ARG n 1 10 PRO n 1 11 ARG n 1 12 LEU n 1 13 SER n 1 14 GLN n 1 15 LEU n 1 16 SER n 1 17 VAL n 1 18 THR n 1 19 ASP n 1 20 VAL n 1 21 THR n 1 22 THR n 1 23 SER n 1 24 SER n 1 25 LEU n 1 26 ARG n 1 27 LEU n 1 28 ASN n 1 29 TRP n 1 30 GLU n 1 31 ALA n 1 32 PRO n 1 33 PRO n 1 34 GLY n 1 35 ALA n 1 36 PHE n 1 37 ASP n 1 38 SER n 1 39 PHE n 1 40 LEU n 1 41 LEU n 1 42 ARG n 1 43 PHE n 1 44 GLY n 1 45 VAL n 1 46 PRO n 1 47 SER n 1 48 PRO n 1 49 SER n 1 50 THR n 1 51 LEU n 1 52 GLU n 1 53 PRO n 1 54 HIS n 1 55 PRO n 1 56 ARG n 1 57 PRO n 1 58 LEU n 1 59 LEU n 1 60 GLN n 1 61 ARG n 1 62 GLU n 1 63 LEU n 1 64 MET n 1 65 VAL n 1 66 PRO n 1 67 GLY n 1 68 THR n 1 69 ARG n 1 70 HIS n 1 71 SER n 1 72 ALA n 1 73 VAL n 1 74 LEU n 1 75 ARG n 1 76 ASP n 1 77 LEU n 1 78 ARG n 1 79 SER n 1 80 GLY n 1 81 THR n 1 82 LEU n 1 83 TYR n 1 84 SER n 1 85 LEU n 1 86 THR n 1 87 LEU n 1 88 TYR n 1 89 GLY n 1 90 LEU n 1 91 ARG n 1 92 GLY n 1 93 PRO n 1 94 HIS n 1 95 LYS n 1 96 ALA n 1 97 ASP n 1 98 SER n 1 99 ILE n 1 100 GLN n 1 101 GLY n 1 102 THR n 1 103 ALA n 1 104 ARG n 1 105 THR n 1 106 LEU n 1 107 SER n 1 108 GLY n 1 109 PRO n 1 110 SER n 1 111 SER n 1 112 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene TNXB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050131-02 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TENX_HUMAN _struct_ref.pdbx_db_accession P22105 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SRPRLSQLSVTDVTTSSLRLNWEAPPGAFDSFLLRFGVPSPSTLEPHPRPLLQRELMVPGTRHSAVLRDLRSGTLYSLTL YGLRGPHKADSIQGTARTL ; _struct_ref.pdbx_align_begin 3699 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CUI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 106 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22105 _struct_ref_seq.db_align_beg 3699 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 3797 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 106 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CUI GLY A 1 ? UNP P22105 ? ? 'cloning artifact' 1 1 1 2CUI SER A 2 ? UNP P22105 ? ? 'cloning artifact' 2 2 1 2CUI SER A 3 ? UNP P22105 ? ? 'cloning artifact' 3 3 1 2CUI GLY A 4 ? UNP P22105 ? ? 'cloning artifact' 4 4 1 2CUI SER A 5 ? UNP P22105 ? ? 'cloning artifact' 5 5 1 2CUI SER A 6 ? UNP P22105 ? ? 'cloning artifact' 6 6 1 2CUI GLY A 7 ? UNP P22105 ? ? 'cloning artifact' 7 7 1 2CUI SER A 107 ? UNP P22105 ? ? 'cloning artifact' 107 8 1 2CUI GLY A 108 ? UNP P22105 ? ? 'cloning artifact' 108 9 1 2CUI PRO A 109 ? UNP P22105 ? ? 'cloning artifact' 109 10 1 2CUI SER A 110 ? UNP P22105 ? ? 'cloning artifact' 110 11 1 2CUI SER A 111 ? UNP P22105 ? ? 'cloning artifact' 111 12 1 2CUI GLY A 112 ? UNP P22105 ? ? 'cloning artifact' 112 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.23mM protein U-15N, 13C; 20mM d-TrisHCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CUI _pdbx_nmr_refine.method 'torsion angle dynamics, restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CUI _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CUI _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.9295 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2CUI _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CUI _struct.title 'Solution structure of the 31st fibronectin type III domain of the human tenascin X' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CUI _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text ;fibronectin type III domain, tenascin X precursor, extracellular matirx, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 16 ? THR A 21 ? SER A 16 THR A 21 A 2 SER A 24 ? ASN A 28 ? SER A 24 ASN A 28 A 3 SER A 71 ? LEU A 74 ? SER A 71 LEU A 74 B 1 ARG A 61 ? PRO A 66 ? ARG A 61 PRO A 66 B 2 SER A 38 ? GLY A 44 ? SER A 38 GLY A 44 B 3 LEU A 82 ? LEU A 90 ? LEU A 82 LEU A 90 B 4 LYS A 95 ? ARG A 104 ? LYS A 95 ARG A 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 18 ? N THR A 18 O ARG A 26 ? O ARG A 26 A 2 3 N LEU A 27 ? N LEU A 27 O ALA A 72 ? O ALA A 72 B 1 2 O VAL A 65 ? O VAL A 65 N PHE A 39 ? N PHE A 39 B 2 3 N ARG A 42 ? N ARG A 42 O THR A 86 ? O THR A 86 B 3 4 N TYR A 83 ? N TYR A 83 O ALA A 103 ? O ALA A 103 # _database_PDB_matrix.entry_id 2CUI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CUI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 GLY 112 112 112 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-26 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 20 ? ? -46.30 103.91 2 1 HIS A 70 ? ? -119.18 67.44 3 1 LEU A 90 ? ? -58.88 107.53 4 2 ARG A 9 ? ? 39.71 53.54 5 2 VAL A 20 ? ? -45.72 103.31 6 2 HIS A 70 ? ? -118.55 67.57 7 3 ASP A 19 ? ? 71.90 32.42 8 3 VAL A 20 ? ? -45.57 103.08 9 3 HIS A 70 ? ? -117.27 67.48 10 3 LEU A 90 ? ? -56.76 108.60 11 3 SER A 111 ? ? -52.16 173.40 12 4 VAL A 20 ? ? -45.83 104.33 13 4 PRO A 55 ? ? -69.72 0.87 14 4 HIS A 70 ? ? -117.71 67.60 15 5 SER A 2 ? ? -121.50 -51.45 16 5 VAL A 20 ? ? -48.94 103.09 17 5 LEU A 25 ? ? -174.44 -179.86 18 5 PRO A 55 ? ? -69.80 2.20 19 5 HIS A 70 ? ? -117.80 67.29 20 6 VAL A 20 ? ? -45.94 103.16 21 6 ALA A 35 ? ? -90.25 -66.68 22 6 LEU A 59 ? ? -61.99 98.40 23 6 HIS A 70 ? ? -117.20 67.71 24 6 THR A 105 ? ? -58.95 170.88 25 6 PRO A 109 ? ? -69.72 2.04 26 7 VAL A 20 ? ? -45.92 104.19 27 7 PRO A 55 ? ? -69.69 2.53 28 7 HIS A 70 ? ? -117.53 67.35 29 8 VAL A 20 ? ? -50.44 103.20 30 8 LEU A 25 ? ? -174.90 -179.22 31 8 HIS A 70 ? ? -116.10 67.42 32 9 SER A 8 ? ? -37.17 153.69 33 9 VAL A 20 ? ? -47.72 102.88 34 9 LEU A 25 ? ? -175.45 -179.89 35 9 PRO A 55 ? ? -69.71 0.21 36 9 SER A 110 ? ? -69.45 91.81 37 10 SER A 5 ? ? -120.97 -56.32 38 10 VAL A 20 ? ? -48.26 105.29 39 10 LEU A 25 ? ? -172.51 -179.17 40 10 PRO A 55 ? ? -69.83 3.19 41 10 HIS A 70 ? ? -117.25 67.51 42 11 VAL A 20 ? ? -51.24 103.03 43 11 HIS A 70 ? ? -116.91 67.69 44 12 VAL A 20 ? ? -51.85 102.89 45 12 HIS A 70 ? ? -116.36 67.34 46 13 VAL A 20 ? ? -46.10 103.88 47 13 PRO A 55 ? ? -69.78 3.43 48 13 HIS A 70 ? ? -117.45 67.72 49 14 SER A 6 ? ? -87.67 41.85 50 14 VAL A 20 ? ? -50.07 104.05 51 14 LEU A 25 ? ? -172.11 -179.43 52 14 HIS A 70 ? ? -116.79 67.50 53 15 VAL A 20 ? ? -47.01 104.25 54 15 PRO A 55 ? ? -69.85 3.13 55 15 HIS A 70 ? ? -116.89 67.59 56 15 PRO A 109 ? ? -69.76 2.81 57 15 SER A 111 ? ? -162.96 119.51 58 16 VAL A 20 ? ? -48.57 103.05 59 16 HIS A 70 ? ? -118.09 67.54 60 17 SER A 6 ? ? -100.58 40.76 61 17 VAL A 20 ? ? -46.90 103.36 62 17 LEU A 25 ? ? -171.35 -179.13 63 17 PRO A 55 ? ? -69.79 3.15 64 17 HIS A 70 ? ? -118.34 67.67 65 18 VAL A 20 ? ? -49.07 103.45 66 18 LEU A 25 ? ? -174.21 -179.69 67 18 HIS A 70 ? ? -116.85 67.08 68 18 SER A 110 ? ? -60.33 94.34 69 19 VAL A 20 ? ? -49.87 106.62 70 19 HIS A 70 ? ? -118.80 67.52 71 19 LEU A 90 ? ? -59.97 108.92 72 19 THR A 105 ? ? -58.97 176.51 73 20 VAL A 20 ? ? -49.54 103.08 74 20 PRO A 55 ? ? -69.80 2.43 75 20 HIS A 70 ? ? -118.07 67.30 76 20 THR A 105 ? ? -59.40 175.95 #