data_2CVR # _entry.id 2CVR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CVR pdb_00002cvr 10.2210/pdb2cvr/pdb RCSB RCSB024677 ? ? WWPDB D_1000024677 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2012-04-04 _pdbx_database_PDB_obs_spr.pdb_id 2CVR _pdbx_database_PDB_obs_spr.replace_pdb_id 1R83 _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1JIC 'SSO7D RECOMBINANT WILD TYPE PROTEIN' unspecified PDB 1B4O 'F31A MUTANT OF THE RECOMBINANT SSO7D' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CVR _pdbx_database_status.recvd_initial_deposition_date 2005-06-13 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Arosio, I.' 1 'Recca, T.' 2 'Consonni, R.' 3 'Alberti, E.' 4 'Fusi, P.' 5 'Zetta, L.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Structural Determinants Responsible for the Thermostability of Sso7d and its Single Point Mutants ; 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 ;A single-point mutation in the extreme heat- and pressure-resistant sso7d protein from sulfolobus solfataricus leads to a major rearrangement of the hydrophobic core ; Biochemistry 38 12709 12717 1999 BICHAW US 0006-2960 0033 ? 10504241 10.1021/bi9911280 2 'Investigations of Sso7d catalytic residues by NMR titration shifts and electrostatic calculations' Biochemistry 42 1421 1429 2003 BICHAW US 0006-2960 0033 ? 12578354 10.1021/bi0265168 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Arosio, I.' 1 ? primary 'Recca, T.' 2 ? primary 'Consonni, R.' 3 ? primary 'Alberti, E.' 4 ? primary 'Fusi, P.' 5 ? primary 'Zetta, L.' 6 ? 1 'Consonni, R.' 7 ? 1 'Santomo, L.' 8 ? 1 'Fusi, P.' 9 ? 1 'Tortora, P.' 10 ? 1 'Zetta, L.' 11 ? 2 'Consonni, R.' 12 ? 2 'Arosio, I.' 13 ? 2 'Belloni, B.' 14 ? 2 'Fogolari, F.' 15 ? 2 'Fusi, P.' 16 ? 2 'Shehi, E.' 17 ? 2 'Zetta, L.' 18 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DNA-binding protein 7a' _entity.formula_weight 7018.202 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.27.- _entity.pdbx_mutation K12L _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'sso7d, 7 kDa DNA-binding protein a, Endoribonuclease P2, p7ss' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ATVKFKYKGEELQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK _entity_poly.pdbx_seq_one_letter_code_can ATVKFKYKGEELQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 VAL n 1 4 LYS n 1 5 PHE n 1 6 LYS n 1 7 TYR n 1 8 LYS n 1 9 GLY n 1 10 GLU n 1 11 GLU n 1 12 LEU n 1 13 GLN n 1 14 VAL n 1 15 ASP n 1 16 ILE n 1 17 SER n 1 18 LYS n 1 19 ILE n 1 20 LYS n 1 21 LYS n 1 22 VAL n 1 23 TRP n 1 24 ARG n 1 25 VAL n 1 26 GLY n 1 27 LYS n 1 28 MET n 1 29 ILE n 1 30 SER n 1 31 PHE n 1 32 THR n 1 33 TYR n 1 34 ASP n 1 35 GLU n 1 36 GLY n 1 37 GLY n 1 38 GLY n 1 39 LYS n 1 40 THR n 1 41 GLY n 1 42 ARG n 1 43 GLY n 1 44 ALA n 1 45 VAL n 1 46 SER n 1 47 GLU n 1 48 LYS n 1 49 ASP n 1 50 ALA n 1 51 PRO n 1 52 LYS n 1 53 GLU n 1 54 LEU n 1 55 LEU n 1 56 GLN n 1 57 MET n 1 58 LEU n 1 59 GLU n 1 60 LYS n 1 61 GLN n 1 62 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Sulfolobus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sulfolobus solfataricus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3) PLYSE' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PT7-7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DN71_SULSO _struct_ref.pdbx_db_accession P61991 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CVR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 62 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P61991 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 62 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 62 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2CVR _struct_ref_seq_dif.mon_id LEU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 12 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P61991 _struct_ref_seq_dif.db_mon_id LYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 12 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 12 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 DQF-COSY 1 2 1 '2D TOCSY' 1 3 1 '2D NOESY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2mM K12L; 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '2mM K12L; 100% D2O' '100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CVR _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The structures are based on a total of 683 restraints, 660 are noe-derived distance constraints, 7 dihedral angle restraints, 16 distance restraints from hydrogen bonds. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CVR _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 12 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CVR _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement Discover 3.0 DAUBER-OSGUTHORPE 1 'data analysis' Felix 98.0 msi 2 'structure solution' Discover 3.0 msi 3 'structure solution' XwinNMR 2.6 Bruker 4 # _exptl.entry_id 2CVR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CVR _struct.title 'NMR solution structure of sso7d mutant, K12L, 12 conformers' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2CVR _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'DNA-binding protein, thermostable protein, Sulfolobus solfataricus, single point mutation, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 16 ? ILE A 19 ? ILE A 16 ILE A 19 5 ? 4 HELX_P HELX_P2 2 LYS A 52 ? LEU A 58 ? LYS A 52 LEU A 58 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LYS 21 A . ? LYS 21 A VAL 22 A ? VAL 22 A 3 7.27 2 LEU 58 A . ? LEU 58 A GLU 59 A ? GLU 59 A 3 -1.02 3 LYS 39 A . ? LYS 39 A THR 40 A ? THR 40 A 8 4.52 4 GLU 35 A . ? GLU 35 A GLY 36 A ? GLY 36 A 9 -0.81 5 LEU 58 A . ? LEU 58 A GLU 59 A ? GLU 59 A 9 1.93 6 TYR 7 A . ? TYR 7 A LYS 8 A ? LYS 8 A 10 0.34 7 LYS 8 A . ? LYS 8 A GLY 9 A ? GLY 9 A 10 -8.35 8 LYS 21 A . ? LYS 21 A VAL 22 A ? VAL 22 A 11 3.12 9 GLU 35 A . ? GLU 35 A GLY 36 A ? GLY 36 A 11 0.78 10 LEU 58 A . ? LEU 58 A GLU 59 A ? GLU 59 A 12 -0.80 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 2 ? TYR A 7 ? THR A 2 TYR A 7 A 2 GLU A 10 ? ILE A 16 ? GLU A 10 ILE A 16 B 1 VAL A 22 ? VAL A 25 ? VAL A 22 VAL A 25 B 2 MET A 28 ? GLU A 35 ? MET A 28 GLU A 35 B 3 THR A 40 ? GLU A 47 ? THR A 40 GLU A 47 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 3 ? O VAL A 3 N VAL A 14 ? N VAL A 14 B 1 2 N LYS A 21 ? N LYS A 21 O THR A 32 ? O THR A 32 B 2 3 O TYR A 33 ? O TYR A 33 N GLY A 41 ? N GLY A 41 # _database_PDB_matrix.entry_id 2CVR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CVR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 LYS 62 62 62 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-08-29 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2012-04-04 5 'Structure model' 1 4 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' Other 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_nmr_software 3 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_nmr_software.name' 4 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; 700 ;SHEET DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HB2 A LYS 21 ? ? OG1 A THR 32 ? ? 0.98 2 1 HB2 A LYS 21 ? ? HG1 A THR 32 ? ? 1.11 3 1 CB A LYS 21 ? ? OG1 A THR 32 ? ? 2.02 4 2 HG3 A LYS 21 ? ? HZ3 A TRP 23 ? ? 1.14 5 8 O A TYR 7 ? ? HG2 A LYS 8 ? ? 1.19 6 9 HA A LEU 58 ? ? HB3 A GLU 59 ? ? 1.00 7 11 HG2 A LYS 27 ? ? HG3 A MET 28 ? ? 1.11 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 35 ? ? OE2 A GLU 35 ? ? 1.370 1.252 0.118 0.011 N 2 2 CD A GLU 35 ? ? OE2 A GLU 35 ? ? 1.370 1.252 0.118 0.011 N 3 3 CD A GLU 35 ? ? OE2 A GLU 35 ? ? 1.370 1.252 0.118 0.011 N 4 4 CD A GLU 35 ? ? OE2 A GLU 35 ? ? 1.371 1.252 0.119 0.011 N 5 5 CD A GLU 35 ? ? OE2 A GLU 35 ? ? 1.370 1.252 0.118 0.011 N 6 6 CD A GLU 35 ? ? OE2 A GLU 35 ? ? 1.370 1.252 0.118 0.011 N 7 7 CD A GLU 35 ? ? OE2 A GLU 35 ? ? 1.370 1.252 0.118 0.011 N 8 8 CD A GLU 35 ? ? OE2 A GLU 35 ? ? 1.370 1.252 0.118 0.011 N 9 9 CD A GLU 35 ? ? OE2 A GLU 35 ? ? 1.370 1.252 0.118 0.011 N 10 10 CD A GLU 35 ? ? OE2 A GLU 35 ? ? 1.370 1.252 0.118 0.011 N 11 11 CD A GLU 35 ? ? OE2 A GLU 35 ? ? 1.370 1.252 0.118 0.011 N 12 12 CD A GLU 35 ? ? OE2 A GLU 35 ? ? 1.369 1.252 0.117 0.011 N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LYS _pdbx_validate_rmsd_angle.auth_seq_id_1 27 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LYS _pdbx_validate_rmsd_angle.auth_seq_id_2 27 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LYS _pdbx_validate_rmsd_angle.auth_seq_id_3 27 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 133.47 _pdbx_validate_rmsd_angle.angle_target_value 113.40 _pdbx_validate_rmsd_angle.angle_deviation 20.07 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.20 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 5 ? ? -160.91 76.75 2 1 LYS A 8 ? ? -136.62 -98.28 3 1 GLU A 35 ? ? -162.27 81.00 4 1 THR A 40 ? ? 59.23 96.78 5 1 ASP A 49 ? ? -159.41 74.18 6 2 TYR A 7 ? ? -91.81 -87.88 7 2 LYS A 8 ? ? -115.04 -70.70 8 2 LYS A 21 ? ? 67.25 93.25 9 2 LYS A 27 ? ? -94.41 -69.01 10 2 GLU A 35 ? ? -163.64 67.30 11 2 LYS A 39 ? ? 168.18 63.25 12 2 GLU A 47 ? ? -97.78 43.69 13 2 ASP A 49 ? ? -160.30 57.14 14 2 GLU A 59 ? ? -160.39 38.90 15 3 LYS A 20 ? ? -76.80 -76.89 16 3 VAL A 22 ? ? 56.61 95.21 17 3 GLU A 35 ? ? -166.19 84.20 18 3 GLU A 59 ? ? -154.16 -91.29 19 3 LYS A 60 ? ? 146.35 148.89 20 3 GLN A 61 ? ? -125.28 -100.75 21 4 GLU A 10 ? ? 174.61 136.33 22 4 LYS A 20 ? ? -91.24 -74.99 23 4 LYS A 27 ? ? 102.86 -50.05 24 4 GLU A 35 ? ? -164.37 78.58 25 4 LYS A 39 ? ? -153.68 77.60 26 4 GLU A 59 ? ? -152.20 66.72 27 5 PHE A 5 ? ? -164.63 86.03 28 5 TYR A 7 ? ? -85.39 -80.86 29 5 LYS A 20 ? ? -93.88 -89.17 30 5 ASP A 49 ? ? -159.28 47.34 31 5 GLU A 59 ? ? -101.04 64.89 32 6 TYR A 7 ? ? -143.94 -89.44 33 6 LYS A 8 ? ? -103.42 -76.68 34 6 LYS A 20 ? ? -92.88 -102.95 35 6 VAL A 25 ? ? -159.01 35.74 36 6 LYS A 27 ? ? -84.07 -73.91 37 6 GLU A 35 ? ? -164.10 89.08 38 6 THR A 40 ? ? 57.79 98.38 39 6 ASP A 49 ? ? -151.03 61.31 40 6 GLN A 61 ? ? -115.75 -108.73 41 7 TYR A 7 ? ? -144.92 -81.28 42 7 LYS A 8 ? ? -111.61 -78.08 43 7 LYS A 21 ? ? 57.27 93.32 44 7 LYS A 27 ? ? 154.00 73.56 45 7 MET A 28 ? ? 60.08 -177.29 46 7 GLU A 35 ? ? -165.51 76.46 47 7 LYS A 39 ? ? -147.06 -40.06 48 7 THR A 40 ? ? 53.00 -168.60 49 7 ASP A 49 ? ? -106.53 47.46 50 8 LYS A 21 ? ? 73.47 116.52 51 8 THR A 40 ? ? 63.26 74.70 52 8 GLU A 59 ? ? -166.48 74.42 53 9 PHE A 5 ? ? -163.04 80.54 54 9 TYR A 7 ? ? -77.27 -88.34 55 9 LYS A 8 ? ? -106.63 -73.98 56 9 LYS A 21 ? ? 69.99 92.24 57 9 LYS A 27 ? ? -155.96 -63.58 58 9 LYS A 39 ? ? -134.23 -38.78 59 9 THR A 40 ? ? 55.20 86.14 60 9 GLU A 59 ? ? 178.34 -171.90 61 10 TYR A 7 ? ? -167.16 97.70 62 10 LYS A 20 ? ? -147.53 -0.93 63 10 GLU A 35 ? ? -164.87 77.13 64 10 LYS A 39 ? ? -157.71 71.64 65 10 GLN A 61 ? ? -122.03 -136.35 66 11 PHE A 5 ? ? -159.76 80.73 67 11 TYR A 7 ? ? -101.80 -96.70 68 11 VAL A 22 ? ? 68.38 82.44 69 11 VAL A 25 ? ? -163.58 24.45 70 11 MET A 28 ? ? 62.22 -177.35 71 11 GLU A 35 ? ? -159.76 77.52 72 11 LYS A 39 ? ? -82.03 -81.64 73 11 THR A 40 ? ? 57.10 91.46 74 11 ASP A 49 ? ? -163.77 53.82 75 11 GLU A 59 ? ? -131.55 -32.17 76 11 LYS A 60 ? ? 65.58 95.04 77 11 GLN A 61 ? ? -102.17 -114.51 78 12 TYR A 7 ? ? -137.04 -80.01 79 12 LYS A 8 ? ? -110.92 -76.13 80 12 LYS A 21 ? ? 76.21 132.80 81 12 LYS A 27 ? ? -83.15 -77.24 82 12 GLU A 35 ? ? -137.71 -59.07 83 12 LYS A 39 ? ? -117.57 64.31 84 12 PRO A 51 ? ? -49.79 155.13 #