data_2CX1 # _entry.id 2CX1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2CX1 RCSB RCSB024722 WWPDB D_1000024722 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2CX0 'the same protein' unspecified TargetDB ape001000525.2 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CX1 _pdbx_database_status.recvd_initial_deposition_date 2005-06-27 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mizohata, E.' 1 'Morita, S.' 2 'Nagano, K.' 3 'Uda, H.' 4 'Terada, T.' 5 'Shirouzu, M.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (tartrate complex)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Mizohata, E.' 1 primary 'Morita, S.' 2 primary 'Nagano, K.' 3 primary 'Uda, H.' 4 primary 'Terada, T.' 5 primary 'Shirouzu, M.' 6 primary 'Yokoyama, S.' 7 # _cell.entry_id 2CX1 _cell.length_a 39.271 _cell.length_b 49.139 _cell.length_c 53.491 _cell.angle_alpha 90.00 _cell.angle_beta 103.21 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2CX1 _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'hypothetical protein APE0525' 21046.092 1 ? ? ? ? 2 non-polymer syn 'L(+)-TARTARIC ACID' 150.087 1 ? ? ? ? 3 water nat water 18.015 178 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;H(MSE)LWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRI YPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHL(MSE)IPGVVGVEGSFTRGDVVAALYHETRTPV(MSE)VGVAEVD SSALEKLYREKARGRAVRRVHRLGDALWELAQEVGKRLS ; _entity_poly.pdbx_seq_one_letter_code_can ;HMLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTL QCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKA RGRAVRRVHRLGDALWELAQEVGKRLS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ape001000525.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 MSE n 1 3 LEU n 1 4 TRP n 1 5 ALA n 1 6 ARG n 1 7 LEU n 1 8 VAL n 1 9 GLY n 1 10 LEU n 1 11 ALA n 1 12 ARG n 1 13 LEU n 1 14 GLU n 1 15 ALA n 1 16 ARG n 1 17 ALA n 1 18 LEU n 1 19 SER n 1 20 LYS n 1 21 LYS n 1 22 GLU n 1 23 ARG n 1 24 ARG n 1 25 SER n 1 26 LEU n 1 27 LEU n 1 28 GLU n 1 29 ARG n 1 30 LEU n 1 31 LYS n 1 32 PRO n 1 33 TYR n 1 34 TYR n 1 35 THR n 1 36 ARG n 1 37 ILE n 1 38 PRO n 1 39 PHE n 1 40 SER n 1 41 GLU n 1 42 LYS n 1 43 ALA n 1 44 ASP n 1 45 LEU n 1 46 ARG n 1 47 LEU n 1 48 VAL n 1 49 LYS n 1 50 ALA n 1 51 ARG n 1 52 THR n 1 53 ASP n 1 54 SER n 1 55 GLY n 1 56 GLU n 1 57 TYR n 1 58 GLU n 1 59 ILE n 1 60 ILE n 1 61 THR n 1 62 VAL n 1 63 ASP n 1 64 GLY n 1 65 VAL n 1 66 PRO n 1 67 CYS n 1 68 LEU n 1 69 PHE n 1 70 GLU n 1 71 TRP n 1 72 SER n 1 73 ASP n 1 74 GLY n 1 75 ARG n 1 76 ILE n 1 77 TYR n 1 78 PRO n 1 79 THR n 1 80 LEU n 1 81 GLN n 1 82 CYS n 1 83 LEU n 1 84 LYS n 1 85 ALA n 1 86 PHE n 1 87 GLY n 1 88 VAL n 1 89 ASP n 1 90 TRP n 1 91 LEU n 1 92 LYS n 1 93 GLY n 1 94 VAL n 1 95 VAL n 1 96 LEU n 1 97 VAL n 1 98 ASP n 1 99 LYS n 1 100 GLY n 1 101 ALA n 1 102 ALA n 1 103 ILE n 1 104 ALA n 1 105 LEU n 1 106 ALA n 1 107 LYS n 1 108 GLY n 1 109 ALA n 1 110 HIS n 1 111 LEU n 1 112 MSE n 1 113 ILE n 1 114 PRO n 1 115 GLY n 1 116 VAL n 1 117 VAL n 1 118 GLY n 1 119 VAL n 1 120 GLU n 1 121 GLY n 1 122 SER n 1 123 PHE n 1 124 THR n 1 125 ARG n 1 126 GLY n 1 127 ASP n 1 128 VAL n 1 129 VAL n 1 130 ALA n 1 131 ALA n 1 132 LEU n 1 133 TYR n 1 134 HIS n 1 135 GLU n 1 136 THR n 1 137 ARG n 1 138 THR n 1 139 PRO n 1 140 VAL n 1 141 MSE n 1 142 VAL n 1 143 GLY n 1 144 VAL n 1 145 ALA n 1 146 GLU n 1 147 VAL n 1 148 ASP n 1 149 SER n 1 150 SER n 1 151 ALA n 1 152 LEU n 1 153 GLU n 1 154 LYS n 1 155 LEU n 1 156 TYR n 1 157 ARG n 1 158 GLU n 1 159 LYS n 1 160 ALA n 1 161 ARG n 1 162 GLY n 1 163 ARG n 1 164 ALA n 1 165 VAL n 1 166 ARG n 1 167 ARG n 1 168 VAL n 1 169 HIS n 1 170 ARG n 1 171 LEU n 1 172 GLY n 1 173 ASP n 1 174 ALA n 1 175 LEU n 1 176 TRP n 1 177 GLU n 1 178 LEU n 1 179 ALA n 1 180 GLN n 1 181 GLU n 1 182 VAL n 1 183 GLY n 1 184 LYS n 1 185 ARG n 1 186 LEU n 1 187 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Aeropyrum _entity_src_gen.pdbx_gene_src_gene APE0525 _entity_src_gen.gene_src_species 'Aeropyrum pernix' _entity_src_gen.gene_src_strain K1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aeropyrum pernix' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272557 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'B834(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9YEQ6_AERPE _struct_ref.pdbx_db_accession Q9YEQ6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQ CLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKAR GRAVRRVHRLGDALWELAQEVGKRLS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CX1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 187 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9YEQ6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 186 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 186 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CX1 HIS A 1 ? UNP Q9YEQ6 ? ? 'EXPRESSION TAG' 0 1 1 2CX1 MSE A 2 ? UNP Q9YEQ6 MET 1 'MODIFIED RESIDUE' 1 2 1 2CX1 MSE A 112 ? UNP Q9YEQ6 MET 111 'MODIFIED RESIDUE' 111 3 1 2CX1 MSE A 141 ? UNP Q9YEQ6 MET 140 'MODIFIED RESIDUE' 140 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TLA non-polymer . 'L(+)-TARTARIC ACID' ? 'C4 H6 O6' 150.087 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2CX1 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.42 _exptl_crystal.density_percent_sol 48.29 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pdbx_details 'PEG3350, Sodium tartrate, Sodium chloride, Tris, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM' _diffrn_detector.pdbx_collection_date 2005-05-17 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL44B2' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL44B2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.00000 # _reflns.entry_id 2CX1 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 1.8 _reflns.number_obs 17683 _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 11.9 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 2CX1 _refine.ls_number_reflns_obs 17676 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 344334.52 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 35.74 _refine.ls_d_res_high 1.80 _refine.ls_percent_reflns_obs 95.2 _refine.ls_R_factor_obs 0.163 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.163 _refine.ls_R_factor_R_free 0.192 _refine.ls_R_factor_R_free_error 0.007 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 847 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 18.7 _refine.aniso_B[1][1] 0.35 _refine.aniso_B[2][2] -3.12 _refine.aniso_B[3][3] 2.77 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -1.58 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.396452 _refine.solvent_model_param_bsol 52.0091 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2CX1 _refine_analyze.Luzzati_coordinate_error_obs 0.16 _refine_analyze.Luzzati_sigma_a_obs 0.11 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.21 _refine_analyze.Luzzati_sigma_a_free 0.18 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1445 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 178 _refine_hist.number_atoms_total 1633 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 35.74 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.019 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.8 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.8 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.17 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.80 _refine_ls_shell.d_res_low 1.91 _refine_ls_shell.number_reflns_R_work 2299 _refine_ls_shell.R_factor_R_work 0.184 _refine_ls_shell.percent_reflns_obs 78.1 _refine_ls_shell.R_factor_R_free 0.23 _refine_ls_shell.R_factor_R_free_error 0.023 _refine_ls_shell.percent_reflns_R_free 4.3 _refine_ls_shell.number_reflns_R_free 103 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2CX1 _struct.title 'Crystal structure of a PUA domain (APE0525) from the Aeropyrum pernix K1 (tartrate complex)' _struct.pdbx_descriptor 'hypothetical protein APE0525' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CX1 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;PUA domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details 'unknown. Probably monomer from the crystal structure.' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 19 ? LYS A 31 ? SER A 18 LYS A 30 1 ? 13 HELX_P HELX_P2 2 PRO A 32 ? TYR A 34 ? PRO A 31 TYR A 33 5 ? 3 HELX_P HELX_P3 3 THR A 79 ? GLY A 87 ? THR A 78 GLY A 86 1 ? 9 HELX_P HELX_P4 4 ASP A 98 ? LYS A 107 ? ASP A 97 LYS A 106 1 ? 10 HELX_P HELX_P5 5 ASP A 148 ? LYS A 159 ? ASP A 147 LYS A 158 1 ? 12 HELX_P HELX_P6 6 ASP A 173 ? LYS A 184 ? ASP A 172 LYS A 183 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A HIS 1 C ? ? ? 1_555 A MSE 2 N ? ? A HIS 0 A MSE 1 1_555 ? ? ? ? ? ? ? 1.329 ? covale2 covale ? ? A MSE 2 C ? ? ? 1_555 A LEU 3 N ? ? A MSE 1 A LEU 2 1_555 ? ? ? ? ? ? ? 1.327 ? covale3 covale ? ? A LEU 111 C ? ? ? 1_555 A MSE 112 N ? ? A LEU 110 A MSE 111 1_555 ? ? ? ? ? ? ? 1.341 ? covale4 covale ? ? A MSE 112 C ? ? ? 1_555 A ILE 113 N ? ? A MSE 111 A ILE 112 1_555 ? ? ? ? ? ? ? 1.336 ? covale5 covale ? ? A VAL 140 C ? ? ? 1_555 A MSE 141 N ? ? A VAL 139 A MSE 140 1_555 ? ? ? ? ? ? ? 1.315 ? covale6 covale ? ? A MSE 141 C ? ? ? 1_555 A VAL 142 N ? ? A MSE 140 A VAL 141 1_555 ? ? ? ? ? ? ? 1.347 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? parallel B 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MSE A 2 ? ALA A 5 ? MSE A 1 ALA A 4 A 2 GLY A 9 ? ALA A 17 ? GLY A 8 ALA A 16 A 3 LEU A 45 ? ARG A 51 ? LEU A 44 ARG A 50 A 4 GLU A 56 ? VAL A 62 ? GLU A 55 VAL A 61 A 5 VAL A 65 ? GLU A 70 ? VAL A 64 GLU A 69 A 6 ILE A 76 ? PRO A 78 ? ILE A 75 PRO A 77 B 1 LEU A 111 ? MSE A 112 ? LEU A 110 MSE A 111 B 2 ARG A 163 ? ARG A 170 ? ARG A 162 ARG A 169 B 3 THR A 138 ? ALA A 145 ? THR A 137 ALA A 144 B 4 VAL A 128 ? TYR A 133 ? VAL A 127 TYR A 132 B 5 GLY A 93 ? VAL A 97 ? GLY A 92 VAL A 96 B 6 VAL A 116 ? GLY A 121 ? VAL A 115 GLY A 120 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 3 ? N LEU A 2 O ALA A 11 ? O ALA A 10 A 2 3 N GLU A 14 ? N GLU A 13 O LYS A 49 ? O LYS A 48 A 3 4 N ARG A 46 ? N ARG A 45 O THR A 61 ? O THR A 60 A 4 5 N ILE A 60 ? N ILE A 59 O LEU A 68 ? O LEU A 67 A 5 6 N PHE A 69 ? N PHE A 68 O TYR A 77 ? O TYR A 76 B 1 2 N LEU A 111 ? N LEU A 110 O ALA A 164 ? O ALA A 163 B 2 3 O HIS A 169 ? O HIS A 168 N VAL A 142 ? N VAL A 141 B 3 4 O VAL A 140 ? O VAL A 139 N ALA A 131 ? N ALA A 130 B 4 5 O LEU A 132 ? O LEU A 131 N VAL A 97 ? N VAL A 96 B 5 6 N LEU A 96 ? N LEU A 95 O VAL A 117 ? O VAL A 116 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'BINDING SITE FOR RESIDUE TLA A 2001' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 ASP A 98 ? ASP A 97 . ? 1_555 ? 2 AC1 9 PRO A 114 ? PRO A 113 . ? 1_555 ? 3 AC1 9 VAL A 117 ? VAL A 116 . ? 1_555 ? 4 AC1 9 LYS A 159 ? LYS A 158 . ? 1_555 ? 5 AC1 9 HOH C . ? HOH A 2030 . ? 1_555 ? 6 AC1 9 HOH C . ? HOH A 2039 . ? 1_555 ? 7 AC1 9 HOH C . ? HOH A 2065 . ? 1_555 ? 8 AC1 9 HOH C . ? HOH A 2157 . ? 1_555 ? 9 AC1 9 HOH C . ? HOH A 2176 . ? 1_555 ? # _database_PDB_matrix.entry_id 2CX1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CX1 _atom_sites.fract_transf_matrix[1][1] 0.025464 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.005978 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020350 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019203 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 0 0 HIS HIS A . n A 1 2 MSE 2 1 1 MSE MSE A . n A 1 3 LEU 3 2 2 LEU LEU A . n A 1 4 TRP 4 3 3 TRP TRP A . n A 1 5 ALA 5 4 4 ALA ALA A . n A 1 6 ARG 6 5 5 ARG ARG A . n A 1 7 LEU 7 6 6 LEU LEU A . n A 1 8 VAL 8 7 7 VAL VAL A . n A 1 9 GLY 9 8 8 GLY GLY A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 ALA 11 10 10 ALA ALA A . n A 1 12 ARG 12 11 11 ARG ARG A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 GLU 14 13 13 GLU GLU A . n A 1 15 ALA 15 14 14 ALA ALA A . n A 1 16 ARG 16 15 15 ARG ARG A . n A 1 17 ALA 17 16 16 ALA ALA A . n A 1 18 LEU 18 17 17 LEU LEU A . n A 1 19 SER 19 18 18 SER SER A . n A 1 20 LYS 20 19 19 LYS LYS A . n A 1 21 LYS 21 20 20 LYS LYS A . n A 1 22 GLU 22 21 21 GLU GLU A . n A 1 23 ARG 23 22 22 ARG ARG A . n A 1 24 ARG 24 23 23 ARG ARG A . n A 1 25 SER 25 24 24 SER SER A . n A 1 26 LEU 26 25 25 LEU LEU A . n A 1 27 LEU 27 26 26 LEU LEU A . n A 1 28 GLU 28 27 27 GLU GLU A . n A 1 29 ARG 29 28 28 ARG ARG A . n A 1 30 LEU 30 29 29 LEU LEU A . n A 1 31 LYS 31 30 30 LYS LYS A . n A 1 32 PRO 32 31 31 PRO PRO A . n A 1 33 TYR 33 32 32 TYR TYR A . n A 1 34 TYR 34 33 33 TYR TYR A . n A 1 35 THR 35 34 34 THR THR A . n A 1 36 ARG 36 35 35 ARG ARG A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 PRO 38 37 37 PRO PRO A . n A 1 39 PHE 39 38 38 PHE PHE A . n A 1 40 SER 40 39 39 SER SER A . n A 1 41 GLU 41 40 40 GLU GLU A . n A 1 42 LYS 42 41 41 LYS LYS A . n A 1 43 ALA 43 42 42 ALA ALA A . n A 1 44 ASP 44 43 43 ASP ASP A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 ARG 46 45 45 ARG ARG A . n A 1 47 LEU 47 46 46 LEU LEU A . n A 1 48 VAL 48 47 47 VAL VAL A . n A 1 49 LYS 49 48 48 LYS LYS A . n A 1 50 ALA 50 49 49 ALA ALA A . n A 1 51 ARG 51 50 50 ARG ARG A . n A 1 52 THR 52 51 51 THR THR A . n A 1 53 ASP 53 52 52 ASP ASP A . n A 1 54 SER 54 53 53 SER SER A . n A 1 55 GLY 55 54 54 GLY GLY A . n A 1 56 GLU 56 55 55 GLU GLU A . n A 1 57 TYR 57 56 56 TYR TYR A . n A 1 58 GLU 58 57 57 GLU GLU A . n A 1 59 ILE 59 58 58 ILE ILE A . n A 1 60 ILE 60 59 59 ILE ILE A . n A 1 61 THR 61 60 60 THR THR A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 ASP 63 62 62 ASP ASP A . n A 1 64 GLY 64 63 63 GLY GLY A . n A 1 65 VAL 65 64 64 VAL VAL A . n A 1 66 PRO 66 65 65 PRO PRO A . n A 1 67 CYS 67 66 66 CYS CYS A . n A 1 68 LEU 68 67 67 LEU LEU A . n A 1 69 PHE 69 68 68 PHE PHE A . n A 1 70 GLU 70 69 69 GLU GLU A . n A 1 71 TRP 71 70 70 TRP TRP A . n A 1 72 SER 72 71 71 SER SER A . n A 1 73 ASP 73 72 72 ASP ASP A . n A 1 74 GLY 74 73 73 GLY GLY A . n A 1 75 ARG 75 74 74 ARG ARG A . n A 1 76 ILE 76 75 75 ILE ILE A . n A 1 77 TYR 77 76 76 TYR TYR A . n A 1 78 PRO 78 77 77 PRO PRO A . n A 1 79 THR 79 78 78 THR THR A . n A 1 80 LEU 80 79 79 LEU LEU A . n A 1 81 GLN 81 80 80 GLN GLN A . n A 1 82 CYS 82 81 81 CYS CYS A . n A 1 83 LEU 83 82 82 LEU LEU A . n A 1 84 LYS 84 83 83 LYS LYS A . n A 1 85 ALA 85 84 84 ALA ALA A . n A 1 86 PHE 86 85 85 PHE PHE A . n A 1 87 GLY 87 86 86 GLY GLY A . n A 1 88 VAL 88 87 87 VAL VAL A . n A 1 89 ASP 89 88 88 ASP ASP A . n A 1 90 TRP 90 89 89 TRP TRP A . n A 1 91 LEU 91 90 90 LEU LEU A . n A 1 92 LYS 92 91 91 LYS LYS A . n A 1 93 GLY 93 92 92 GLY GLY A . n A 1 94 VAL 94 93 93 VAL VAL A . n A 1 95 VAL 95 94 94 VAL VAL A . n A 1 96 LEU 96 95 95 LEU LEU A . n A 1 97 VAL 97 96 96 VAL VAL A . n A 1 98 ASP 98 97 97 ASP ASP A . n A 1 99 LYS 99 98 98 LYS LYS A . n A 1 100 GLY 100 99 99 GLY GLY A . n A 1 101 ALA 101 100 100 ALA ALA A . n A 1 102 ALA 102 101 101 ALA ALA A . n A 1 103 ILE 103 102 102 ILE ILE A . n A 1 104 ALA 104 103 103 ALA ALA A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 ALA 106 105 105 ALA ALA A . n A 1 107 LYS 107 106 106 LYS LYS A . n A 1 108 GLY 108 107 107 GLY GLY A . n A 1 109 ALA 109 108 108 ALA ALA A . n A 1 110 HIS 110 109 109 HIS HIS A . n A 1 111 LEU 111 110 110 LEU LEU A . n A 1 112 MSE 112 111 111 MSE MSE A . n A 1 113 ILE 113 112 112 ILE ILE A . n A 1 114 PRO 114 113 113 PRO PRO A . n A 1 115 GLY 115 114 114 GLY GLY A . n A 1 116 VAL 116 115 115 VAL VAL A . n A 1 117 VAL 117 116 116 VAL VAL A . n A 1 118 GLY 118 117 117 GLY GLY A . n A 1 119 VAL 119 118 118 VAL VAL A . n A 1 120 GLU 120 119 119 GLU GLU A . n A 1 121 GLY 121 120 120 GLY GLY A . n A 1 122 SER 122 121 121 SER SER A . n A 1 123 PHE 123 122 122 PHE PHE A . n A 1 124 THR 124 123 123 THR THR A . n A 1 125 ARG 125 124 124 ARG ARG A . n A 1 126 GLY 126 125 125 GLY GLY A . n A 1 127 ASP 127 126 126 ASP ASP A . n A 1 128 VAL 128 127 127 VAL VAL A . n A 1 129 VAL 129 128 128 VAL VAL A . n A 1 130 ALA 130 129 129 ALA ALA A . n A 1 131 ALA 131 130 130 ALA ALA A . n A 1 132 LEU 132 131 131 LEU LEU A . n A 1 133 TYR 133 132 132 TYR TYR A . n A 1 134 HIS 134 133 133 HIS HIS A . n A 1 135 GLU 135 134 134 GLU GLU A . n A 1 136 THR 136 135 135 THR THR A . n A 1 137 ARG 137 136 136 ARG ARG A . n A 1 138 THR 138 137 137 THR THR A . n A 1 139 PRO 139 138 138 PRO PRO A . n A 1 140 VAL 140 139 139 VAL VAL A . n A 1 141 MSE 141 140 140 MSE MSE A . n A 1 142 VAL 142 141 141 VAL VAL A . n A 1 143 GLY 143 142 142 GLY GLY A . n A 1 144 VAL 144 143 143 VAL VAL A . n A 1 145 ALA 145 144 144 ALA ALA A . n A 1 146 GLU 146 145 145 GLU GLU A . n A 1 147 VAL 147 146 146 VAL VAL A . n A 1 148 ASP 148 147 147 ASP ASP A . n A 1 149 SER 149 148 148 SER SER A . n A 1 150 SER 150 149 149 SER SER A . n A 1 151 ALA 151 150 150 ALA ALA A . n A 1 152 LEU 152 151 151 LEU LEU A . n A 1 153 GLU 153 152 152 GLU GLU A . n A 1 154 LYS 154 153 153 LYS LYS A . n A 1 155 LEU 155 154 154 LEU LEU A . n A 1 156 TYR 156 155 155 TYR TYR A . n A 1 157 ARG 157 156 156 ARG ARG A . n A 1 158 GLU 158 157 157 GLU GLU A . n A 1 159 LYS 159 158 158 LYS LYS A . n A 1 160 ALA 160 159 159 ALA ALA A . n A 1 161 ARG 161 160 160 ARG ARG A . n A 1 162 GLY 162 161 161 GLY GLY A . n A 1 163 ARG 163 162 162 ARG ARG A . n A 1 164 ALA 164 163 163 ALA ALA A . n A 1 165 VAL 165 164 164 VAL VAL A . n A 1 166 ARG 166 165 165 ARG ARG A . n A 1 167 ARG 167 166 166 ARG ARG A . n A 1 168 VAL 168 167 167 VAL VAL A . n A 1 169 HIS 169 168 168 HIS HIS A . n A 1 170 ARG 170 169 169 ARG ARG A . n A 1 171 LEU 171 170 170 LEU LEU A . n A 1 172 GLY 172 171 171 GLY GLY A . n A 1 173 ASP 173 172 172 ASP ASP A . n A 1 174 ALA 174 173 173 ALA ALA A . n A 1 175 LEU 175 174 174 LEU LEU A . n A 1 176 TRP 176 175 175 TRP TRP A . n A 1 177 GLU 177 176 176 GLU GLU A . n A 1 178 LEU 178 177 177 LEU LEU A . n A 1 179 ALA 179 178 178 ALA ALA A . n A 1 180 GLN 180 179 179 GLN GLN A . n A 1 181 GLU 181 180 180 GLU GLU A . n A 1 182 VAL 182 181 181 VAL VAL A . n A 1 183 GLY 183 182 182 GLY GLY A . n A 1 184 LYS 184 183 183 LYS LYS A . n A 1 185 ARG 185 184 ? ? ? A . n A 1 186 LEU 186 185 ? ? ? A . n A 1 187 SER 187 186 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 TLA 1 2001 1001 TLA TLA A . C 3 HOH 1 2002 1 HOH WAT A . C 3 HOH 2 2003 2 HOH WAT A . C 3 HOH 3 2004 3 HOH WAT A . C 3 HOH 4 2005 4 HOH WAT A . C 3 HOH 5 2006 5 HOH WAT A . C 3 HOH 6 2007 6 HOH WAT A . C 3 HOH 7 2008 7 HOH WAT A . C 3 HOH 8 2009 8 HOH WAT A . C 3 HOH 9 2010 9 HOH WAT A . C 3 HOH 10 2011 10 HOH WAT A . C 3 HOH 11 2012 12 HOH WAT A . C 3 HOH 12 2013 13 HOH WAT A . C 3 HOH 13 2014 14 HOH WAT A . C 3 HOH 14 2015 15 HOH WAT A . C 3 HOH 15 2016 16 HOH WAT A . C 3 HOH 16 2017 17 HOH WAT A . C 3 HOH 17 2018 18 HOH WAT A . C 3 HOH 18 2019 20 HOH WAT A . C 3 HOH 19 2020 21 HOH WAT A . C 3 HOH 20 2021 22 HOH WAT A . C 3 HOH 21 2022 23 HOH WAT A . C 3 HOH 22 2023 24 HOH WAT A . C 3 HOH 23 2024 25 HOH WAT A . C 3 HOH 24 2025 26 HOH WAT A . C 3 HOH 25 2026 27 HOH WAT A . C 3 HOH 26 2027 28 HOH WAT A . C 3 HOH 27 2028 31 HOH WAT A . C 3 HOH 28 2029 32 HOH WAT A . C 3 HOH 29 2030 33 HOH WAT A . C 3 HOH 30 2031 34 HOH WAT A . C 3 HOH 31 2032 35 HOH WAT A . C 3 HOH 32 2033 36 HOH WAT A . C 3 HOH 33 2034 37 HOH WAT A . C 3 HOH 34 2035 38 HOH WAT A . C 3 HOH 35 2036 39 HOH WAT A . C 3 HOH 36 2037 40 HOH WAT A . C 3 HOH 37 2038 41 HOH WAT A . C 3 HOH 38 2039 42 HOH WAT A . C 3 HOH 39 2040 43 HOH WAT A . C 3 HOH 40 2041 44 HOH WAT A . C 3 HOH 41 2042 46 HOH WAT A . C 3 HOH 42 2043 47 HOH WAT A . C 3 HOH 43 2044 48 HOH WAT A . C 3 HOH 44 2045 49 HOH WAT A . C 3 HOH 45 2046 200 HOH WAT A . C 3 HOH 46 2047 201 HOH WAT A . C 3 HOH 47 2048 202 HOH WAT A . C 3 HOH 48 2049 203 HOH WAT A . C 3 HOH 49 2050 204 HOH WAT A . C 3 HOH 50 2051 205 HOH WAT A . C 3 HOH 51 2052 206 HOH WAT A . C 3 HOH 52 2053 207 HOH WAT A . C 3 HOH 53 2054 209 HOH WAT A . C 3 HOH 54 2055 210 HOH WAT A . C 3 HOH 55 2056 211 HOH WAT A . C 3 HOH 56 2057 212 HOH WAT A . C 3 HOH 57 2058 213 HOH WAT A . C 3 HOH 58 2059 214 HOH WAT A . C 3 HOH 59 2060 215 HOH WAT A . C 3 HOH 60 2061 216 HOH WAT A . C 3 HOH 61 2062 217 HOH WAT A . C 3 HOH 62 2063 218 HOH WAT A . C 3 HOH 63 2064 219 HOH WAT A . C 3 HOH 64 2065 220 HOH WAT A . C 3 HOH 65 2066 221 HOH WAT A . C 3 HOH 66 2067 222 HOH WAT A . C 3 HOH 67 2068 223 HOH WAT A . C 3 HOH 68 2069 225 HOH WAT A . C 3 HOH 69 2070 226 HOH WAT A . C 3 HOH 70 2071 227 HOH WAT A . C 3 HOH 71 2072 228 HOH WAT A . C 3 HOH 72 2073 229 HOH WAT A . C 3 HOH 73 2074 230 HOH WAT A . C 3 HOH 74 2075 231 HOH WAT A . C 3 HOH 75 2076 232 HOH WAT A . C 3 HOH 76 2077 233 HOH WAT A . C 3 HOH 77 2078 234 HOH WAT A . C 3 HOH 78 2079 236 HOH WAT A . C 3 HOH 79 2080 237 HOH WAT A . C 3 HOH 80 2081 238 HOH WAT A . C 3 HOH 81 2082 600 HOH WAT A . C 3 HOH 82 2083 601 HOH WAT A . C 3 HOH 83 2084 602 HOH WAT A . C 3 HOH 84 2085 603 HOH WAT A . C 3 HOH 85 2086 604 HOH WAT A . C 3 HOH 86 2087 605 HOH WAT A . C 3 HOH 87 2088 606 HOH WAT A . C 3 HOH 88 2089 607 HOH WAT A . C 3 HOH 89 2090 608 HOH WAT A . C 3 HOH 90 2091 609 HOH WAT A . C 3 HOH 91 2092 610 HOH WAT A . C 3 HOH 92 2093 611 HOH WAT A . C 3 HOH 93 2094 612 HOH WAT A . C 3 HOH 94 2095 613 HOH WAT A . C 3 HOH 95 2096 614 HOH WAT A . C 3 HOH 96 2097 615 HOH WAT A . C 3 HOH 97 2098 617 HOH WAT A . C 3 HOH 98 2099 618 HOH WAT A . C 3 HOH 99 2100 619 HOH WAT A . C 3 HOH 100 2101 620 HOH WAT A . C 3 HOH 101 2102 621 HOH WAT A . C 3 HOH 102 2103 622 HOH WAT A . C 3 HOH 103 2104 623 HOH WAT A . C 3 HOH 104 2105 624 HOH WAT A . C 3 HOH 105 2106 626 HOH WAT A . C 3 HOH 106 2107 627 HOH WAT A . C 3 HOH 107 2108 628 HOH WAT A . C 3 HOH 108 2109 629 HOH WAT A . C 3 HOH 109 2110 630 HOH WAT A . C 3 HOH 110 2111 631 HOH WAT A . C 3 HOH 111 2112 632 HOH WAT A . C 3 HOH 112 2113 633 HOH WAT A . C 3 HOH 113 2114 635 HOH WAT A . C 3 HOH 114 2115 636 HOH WAT A . C 3 HOH 115 2116 638 HOH WAT A . C 3 HOH 116 2117 639 HOH WAT A . C 3 HOH 117 2118 640 HOH WAT A . C 3 HOH 118 2119 641 HOH WAT A . C 3 HOH 119 2120 642 HOH WAT A . C 3 HOH 120 2121 643 HOH WAT A . C 3 HOH 121 2122 644 HOH WAT A . C 3 HOH 122 2123 645 HOH WAT A . C 3 HOH 123 2124 800 HOH WAT A . C 3 HOH 124 2125 801 HOH WAT A . C 3 HOH 125 2126 802 HOH WAT A . C 3 HOH 126 2127 803 HOH WAT A . C 3 HOH 127 2128 804 HOH WAT A . C 3 HOH 128 2129 805 HOH WAT A . C 3 HOH 129 2130 806 HOH WAT A . C 3 HOH 130 2131 807 HOH WAT A . C 3 HOH 131 2132 808 HOH WAT A . C 3 HOH 132 2133 809 HOH WAT A . C 3 HOH 133 2134 810 HOH WAT A . C 3 HOH 134 2135 811 HOH WAT A . C 3 HOH 135 2136 812 HOH WAT A . C 3 HOH 136 2137 813 HOH WAT A . C 3 HOH 137 2138 814 HOH WAT A . C 3 HOH 138 2139 816 HOH WAT A . C 3 HOH 139 2140 817 HOH WAT A . C 3 HOH 140 2141 818 HOH WAT A . C 3 HOH 141 2142 820 HOH WAT A . C 3 HOH 142 2143 821 HOH WAT A . C 3 HOH 143 2144 822 HOH WAT A . C 3 HOH 144 2145 823 HOH WAT A . C 3 HOH 145 2146 825 HOH WAT A . C 3 HOH 146 2147 826 HOH WAT A . C 3 HOH 147 2148 990 HOH WAT A . C 3 HOH 148 2149 991 HOH WAT A . C 3 HOH 149 2150 992 HOH WAT A . C 3 HOH 150 2151 993 HOH WAT A . C 3 HOH 151 2152 994 HOH WAT A . C 3 HOH 152 2153 995 HOH WAT A . C 3 HOH 153 2154 996 HOH WAT A . C 3 HOH 154 2155 999 HOH WAT A . C 3 HOH 155 2156 1000 HOH WAT A . C 3 HOH 156 2157 1001 HOH WAT A . C 3 HOH 157 2158 1002 HOH WAT A . C 3 HOH 158 2159 1003 HOH WAT A . C 3 HOH 159 2160 1004 HOH WAT A . C 3 HOH 160 2161 1005 HOH WAT A . C 3 HOH 161 2162 1007 HOH WAT A . C 3 HOH 162 2163 1008 HOH WAT A . C 3 HOH 163 2164 1009 HOH WAT A . C 3 HOH 164 2165 1010 HOH WAT A . C 3 HOH 165 2166 1011 HOH WAT A . C 3 HOH 166 2167 1012 HOH WAT A . C 3 HOH 167 2168 1013 HOH WAT A . C 3 HOH 168 2169 1014 HOH WAT A . C 3 HOH 169 2170 1015 HOH WAT A . C 3 HOH 170 2171 1017 HOH WAT A . C 3 HOH 171 2172 1200 HOH WAT A . C 3 HOH 172 2173 1201 HOH WAT A . C 3 HOH 173 2174 1203 HOH WAT A . C 3 HOH 174 2175 1204 HOH WAT A . C 3 HOH 175 2176 1205 HOH WAT A . C 3 HOH 176 2177 1206 HOH WAT A . C 3 HOH 177 2178 1207 HOH WAT A . C 3 HOH 178 2179 1208 HOH WAT A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 2 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 112 A MSE 111 ? MET SELENOMETHIONINE 3 A MSE 141 A MSE 140 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-12-27 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 MOLREP phasing . ? 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 2158 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 2176 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_757 _pdbx_validate_symm_contact.dist 2.19 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LEU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 6 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 69.50 _pdbx_validate_torsion.psi -51.96 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 184 ? A ARG 185 2 1 Y 1 A LEU 185 ? A LEU 186 3 1 Y 1 A SER 186 ? A SER 187 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'L(+)-TARTARIC ACID' TLA 3 water HOH #