data_2D4O # _entry.id 2D4O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2D4O pdb_00002d4o 10.2210/pdb2d4o/pdb RCSB RCSB024982 ? ? WWPDB D_1000024982 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2D4P 'the same protein(native)' unspecified TargetDB ttk003001619.2 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2D4O _pdbx_database_status.recvd_initial_deposition_date 2005-10-21 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mizohata, E.' 1 'Uchikubo, T.' 2 'Kinoshita, Y.' 3 'Terada, T.' 4 'Shirouzu, M.' 5 'Kuramitsu, S.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Crystal structure of TTHA1254 (I68M mutant) from Thermus thermophilus HB8' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mizohata, E.' 1 ? primary 'Uchikubo, T.' 2 ? primary 'Kinoshita, Y.' 3 ? primary 'Terada, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Kuramitsu, S.' 6 ? primary 'Yokoyama, S.' 7 ? # _cell.entry_id 2D4O _cell.length_a 58.463 _cell.length_b 58.463 _cell.length_c 77.679 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2D4O _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'hypothetical protein TTHA1254' 15643.442 1 ? I68M ? ? 2 water nat water 18.015 97 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)RFRPFTEEDLDRLNRLAGKRPVSLGALRFFARTGHSFLAEEGEEP(MSE)GFALAQAVWQGEATTVLVTR(MSE) EGRSVEALRGLLRAVVKSAYDAGVYEVALHLDPERKELEEALKAEGFALGPLVLAVRVLGSRGARGETRGVLE ; _entity_poly.pdbx_seq_one_letter_code_can ;MRFRPFTEEDLDRLNRLAGKRPVSLGALRFFARTGHSFLAEEGEEPMGFALAQAVWQGEATTVLVTRMEGRSVEALRGLL RAVVKSAYDAGVYEVALHLDPERKELEEALKAEGFALGPLVLAVRVLGSRGARGETRGVLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ttk003001619.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ARG n 1 3 PHE n 1 4 ARG n 1 5 PRO n 1 6 PHE n 1 7 THR n 1 8 GLU n 1 9 GLU n 1 10 ASP n 1 11 LEU n 1 12 ASP n 1 13 ARG n 1 14 LEU n 1 15 ASN n 1 16 ARG n 1 17 LEU n 1 18 ALA n 1 19 GLY n 1 20 LYS n 1 21 ARG n 1 22 PRO n 1 23 VAL n 1 24 SER n 1 25 LEU n 1 26 GLY n 1 27 ALA n 1 28 LEU n 1 29 ARG n 1 30 PHE n 1 31 PHE n 1 32 ALA n 1 33 ARG n 1 34 THR n 1 35 GLY n 1 36 HIS n 1 37 SER n 1 38 PHE n 1 39 LEU n 1 40 ALA n 1 41 GLU n 1 42 GLU n 1 43 GLY n 1 44 GLU n 1 45 GLU n 1 46 PRO n 1 47 MSE n 1 48 GLY n 1 49 PHE n 1 50 ALA n 1 51 LEU n 1 52 ALA n 1 53 GLN n 1 54 ALA n 1 55 VAL n 1 56 TRP n 1 57 GLN n 1 58 GLY n 1 59 GLU n 1 60 ALA n 1 61 THR n 1 62 THR n 1 63 VAL n 1 64 LEU n 1 65 VAL n 1 66 THR n 1 67 ARG n 1 68 MSE n 1 69 GLU n 1 70 GLY n 1 71 ARG n 1 72 SER n 1 73 VAL n 1 74 GLU n 1 75 ALA n 1 76 LEU n 1 77 ARG n 1 78 GLY n 1 79 LEU n 1 80 LEU n 1 81 ARG n 1 82 ALA n 1 83 VAL n 1 84 VAL n 1 85 LYS n 1 86 SER n 1 87 ALA n 1 88 TYR n 1 89 ASP n 1 90 ALA n 1 91 GLY n 1 92 VAL n 1 93 TYR n 1 94 GLU n 1 95 VAL n 1 96 ALA n 1 97 LEU n 1 98 HIS n 1 99 LEU n 1 100 ASP n 1 101 PRO n 1 102 GLU n 1 103 ARG n 1 104 LYS n 1 105 GLU n 1 106 LEU n 1 107 GLU n 1 108 GLU n 1 109 ALA n 1 110 LEU n 1 111 LYS n 1 112 ALA n 1 113 GLU n 1 114 GLY n 1 115 PHE n 1 116 ALA n 1 117 LEU n 1 118 GLY n 1 119 PRO n 1 120 LEU n 1 121 VAL n 1 122 LEU n 1 123 ALA n 1 124 VAL n 1 125 ARG n 1 126 VAL n 1 127 LEU n 1 128 GLY n 1 129 SER n 1 130 ARG n 1 131 GLY n 1 132 ALA n 1 133 ARG n 1 134 GLY n 1 135 GLU n 1 136 THR n 1 137 ARG n 1 138 GLY n 1 139 VAL n 1 140 LEU n 1 141 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Thermus thermophilus' _entity_src_gen.gene_src_strain HB8 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 300852 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'B834(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q72J89_THET2 _struct_ref.pdbx_db_accession Q72J89 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2D4O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 141 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q72J89 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 141 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 141 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2D4O MSE A 1 ? UNP Q72J89 MET 1 'modified residue' 1 1 1 2D4O MSE A 47 ? UNP Q72J89 MET 47 'modified residue' 47 2 1 2D4O MSE A 68 ? UNP Q72J89 ILE 68 'engineered mutation' 68 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2D4O _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.45 _exptl_crystal.density_percent_sol 49.77 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pdbx_details 'PEG3350, Hepes, NaCl, pH 7, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RIGAKU JUPITER 210' _diffrn_detector.pdbx_collection_date 2005-09-30 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.96300 1.0 2 0.97896 1.0 3 0.97932 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL26B1' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL26B1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.96300, 0.97896, 0.97932' # _reflns.entry_id 2D4O _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 1.8 _reflns.number_obs 14538 _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 2D4O _refine.ls_number_reflns_obs 13292 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.00 _refine.ls_d_res_high 1.80 _refine.ls_percent_reflns_obs 95.14 _refine.ls_R_factor_obs 0.18305 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.18041 _refine.ls_R_factor_R_free 0.23574 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 705 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.960 _refine.correlation_coeff_Fo_to_Fc_free 0.926 _refine.B_iso_mean 17.496 _refine.aniso_B[1][1] 0.28 _refine.aniso_B[2][2] 0.28 _refine.aniso_B[3][3] -0.42 _refine.aniso_B[1][2] 0.14 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.119 _refine.pdbx_overall_ESU_R_Free 0.127 _refine.overall_SU_ML 0.091 _refine.overall_SU_B 3.149 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1011 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 97 _refine_hist.number_atoms_total 1108 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 50.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.016 0.021 ? 1028 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 994 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.487 1.980 ? 1385 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.827 3.000 ? 2280 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.208 5.000 ? 129 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_chiral_restr 0.083 0.200 ? 154 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 1153 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.006 0.020 ? 232 'X-RAY DIFFRACTION' ? r_nbd_refined 0.205 0.200 ? 153 'X-RAY DIFFRACTION' ? r_nbd_other 0.251 0.200 ? 1041 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other 0.083 0.200 ? 679 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.140 0.200 ? 68 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.142 0.200 ? 6 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.440 0.200 ? 50 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.118 0.200 ? 13 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.764 1.500 ? 642 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.389 2.000 ? 1016 'X-RAY DIFFRACTION' ? r_scbond_it 2.619 3.000 ? 386 'X-RAY DIFFRACTION' ? r_scangle_it 4.406 4.500 ? 369 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.799 _refine_ls_shell.d_res_low 1.846 _refine_ls_shell.number_reflns_R_work 726 _refine_ls_shell.R_factor_R_work 0.313 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.328 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 53 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2D4O _struct.title 'Crystal structure of TTHA1254 (I68M mutant) from Thermus thermophilus HB8' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2D4O _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 7 ? GLU A 9 ? THR A 7 GLU A 9 5 ? 3 HELX_P HELX_P2 2 ASP A 10 ? ALA A 18 ? ASP A 10 ALA A 18 1 ? 9 HELX_P HELX_P3 3 SER A 24 ? ARG A 33 ? SER A 24 ARG A 33 1 ? 10 HELX_P HELX_P4 4 SER A 72 ? ALA A 90 ? SER A 72 ALA A 90 1 ? 19 HELX_P HELX_P5 5 ARG A 103 ? GLU A 113 ? ARG A 103 GLU A 113 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 1 C ? ? ? 1_555 A ARG 2 N ? ? A MSE 1 A ARG 2 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale2 covale both ? A PRO 46 C ? ? ? 1_555 A MSE 47 N ? ? A PRO 46 A MSE 47 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale3 covale both ? A MSE 47 C ? ? ? 1_555 A GLY 48 N ? ? A MSE 47 A GLY 48 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale4 covale both ? A ARG 67 C ? ? ? 1_555 A MSE 68 N ? ? A ARG 67 A MSE 68 1_555 ? ? ? ? ? ? ? 1.313 ? ? covale5 covale both ? A MSE 68 C ? ? ? 1_555 A GLU 69 N ? ? A MSE 68 A GLU 69 1_555 ? ? ? ? ? ? ? 1.337 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 118 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 118 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 119 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 119 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 9.46 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 2 ? ARG A 4 ? ARG A 2 ARG A 4 A 2 PHE A 38 ? GLU A 42 ? PHE A 38 GLU A 42 A 3 GLU A 45 ? TRP A 56 ? GLU A 45 TRP A 56 A 4 THR A 61 ? GLY A 70 ? THR A 61 GLY A 70 A 5 GLU A 94 ? LEU A 97 ? GLU A 94 LEU A 97 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 2 ? N ARG A 2 O GLU A 41 ? O GLU A 41 A 2 3 N ALA A 40 ? N ALA A 40 O MSE A 47 ? O MSE A 47 A 3 4 N VAL A 55 ? N VAL A 55 O THR A 62 ? O THR A 62 A 4 5 N VAL A 63 ? N VAL A 63 O ALA A 96 ? O ALA A 96 # _database_PDB_matrix.entry_id 2D4O _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2D4O _atom_sites.fract_transf_matrix[1][1] 0.017105 _atom_sites.fract_transf_matrix[1][2] 0.009875 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019751 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012873 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 MSE 47 47 47 MSE MSE A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 MSE 68 68 68 MSE MSE A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 GLY 131 131 ? ? ? A . n A 1 132 ALA 132 132 ? ? ? A . n A 1 133 ARG 133 133 ? ? ? A . n A 1 134 GLY 134 134 ? ? ? A . n A 1 135 GLU 135 135 ? ? ? A . n A 1 136 THR 136 136 ? ? ? A . n A 1 137 ARG 137 137 ? ? ? A . n A 1 138 GLY 138 138 ? ? ? A . n A 1 139 VAL 139 139 ? ? ? A . n A 1 140 LEU 140 140 ? ? ? A . n A 1 141 GLU 141 141 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 142 1 HOH WAT A . B 2 HOH 2 143 2 HOH WAT A . B 2 HOH 3 144 3 HOH WAT A . B 2 HOH 4 145 4 HOH WAT A . B 2 HOH 5 146 5 HOH WAT A . B 2 HOH 6 147 6 HOH WAT A . B 2 HOH 7 148 7 HOH WAT A . B 2 HOH 8 149 8 HOH WAT A . B 2 HOH 9 150 9 HOH WAT A . B 2 HOH 10 151 10 HOH WAT A . B 2 HOH 11 152 11 HOH WAT A . B 2 HOH 12 153 12 HOH WAT A . B 2 HOH 13 154 13 HOH WAT A . B 2 HOH 14 155 14 HOH WAT A . B 2 HOH 15 156 15 HOH WAT A . B 2 HOH 16 157 16 HOH WAT A . B 2 HOH 17 158 17 HOH WAT A . B 2 HOH 18 159 18 HOH WAT A . B 2 HOH 19 160 19 HOH WAT A . B 2 HOH 20 161 20 HOH WAT A . B 2 HOH 21 162 21 HOH WAT A . B 2 HOH 22 163 22 HOH WAT A . B 2 HOH 23 164 23 HOH WAT A . B 2 HOH 24 165 24 HOH WAT A . B 2 HOH 25 166 25 HOH WAT A . B 2 HOH 26 167 26 HOH WAT A . B 2 HOH 27 168 27 HOH WAT A . B 2 HOH 28 169 28 HOH WAT A . B 2 HOH 29 170 29 HOH WAT A . B 2 HOH 30 171 30 HOH WAT A . B 2 HOH 31 172 31 HOH WAT A . B 2 HOH 32 173 32 HOH WAT A . B 2 HOH 33 174 33 HOH WAT A . B 2 HOH 34 175 34 HOH WAT A . B 2 HOH 35 176 35 HOH WAT A . B 2 HOH 36 177 36 HOH WAT A . B 2 HOH 37 178 37 HOH WAT A . B 2 HOH 38 179 38 HOH WAT A . B 2 HOH 39 180 39 HOH WAT A . B 2 HOH 40 181 40 HOH WAT A . B 2 HOH 41 182 41 HOH WAT A . B 2 HOH 42 183 42 HOH WAT A . B 2 HOH 43 184 43 HOH WAT A . B 2 HOH 44 185 44 HOH WAT A . B 2 HOH 45 186 45 HOH WAT A . B 2 HOH 46 187 46 HOH WAT A . B 2 HOH 47 188 47 HOH WAT A . B 2 HOH 48 189 48 HOH WAT A . B 2 HOH 49 190 49 HOH WAT A . B 2 HOH 50 191 50 HOH WAT A . B 2 HOH 51 192 51 HOH WAT A . B 2 HOH 52 193 52 HOH WAT A . B 2 HOH 53 194 53 HOH WAT A . B 2 HOH 54 195 54 HOH WAT A . B 2 HOH 55 196 55 HOH WAT A . B 2 HOH 56 197 56 HOH WAT A . B 2 HOH 57 198 57 HOH WAT A . B 2 HOH 58 199 58 HOH WAT A . B 2 HOH 59 200 59 HOH WAT A . B 2 HOH 60 201 60 HOH WAT A . B 2 HOH 61 202 61 HOH WAT A . B 2 HOH 62 203 62 HOH WAT A . B 2 HOH 63 204 63 HOH WAT A . B 2 HOH 64 205 64 HOH WAT A . B 2 HOH 65 206 65 HOH WAT A . B 2 HOH 66 207 66 HOH WAT A . B 2 HOH 67 208 67 HOH WAT A . B 2 HOH 68 209 68 HOH WAT A . B 2 HOH 69 210 69 HOH WAT A . B 2 HOH 70 211 70 HOH WAT A . B 2 HOH 71 212 71 HOH WAT A . B 2 HOH 72 213 72 HOH WAT A . B 2 HOH 73 214 73 HOH WAT A . B 2 HOH 74 215 74 HOH WAT A . B 2 HOH 75 216 75 HOH WAT A . B 2 HOH 76 217 76 HOH WAT A . B 2 HOH 77 218 77 HOH WAT A . B 2 HOH 78 219 78 HOH WAT A . B 2 HOH 79 220 79 HOH WAT A . B 2 HOH 80 221 80 HOH WAT A . B 2 HOH 81 222 81 HOH WAT A . B 2 HOH 82 223 82 HOH WAT A . B 2 HOH 83 224 83 HOH WAT A . B 2 HOH 84 225 84 HOH WAT A . B 2 HOH 85 226 85 HOH WAT A . B 2 HOH 86 227 86 HOH WAT A . B 2 HOH 87 228 87 HOH WAT A . B 2 HOH 88 229 88 HOH WAT A . B 2 HOH 89 230 89 HOH WAT A . B 2 HOH 90 231 90 HOH WAT A . B 2 HOH 91 232 91 HOH WAT A . B 2 HOH 92 233 92 HOH WAT A . B 2 HOH 93 234 93 HOH WAT A . B 2 HOH 94 235 94 HOH WAT A . B 2 HOH 95 236 95 HOH WAT A . B 2 HOH 96 237 96 HOH WAT A . B 2 HOH 97 238 97 HOH WAT A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 47 A MSE 47 ? MET SELENOMETHIONINE 3 A MSE 68 A MSE 68 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA,PQS dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1,2 A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 4210 ? 2 MORE -24 ? 2 'SSA (A^2)' 12900 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 77.6790000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-04-21 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Source and taxonomy' 5 3 'Structure model' 'Version format compliance' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' struct_conn 3 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 14.7499 _pdbx_refine_tls.origin_y 31.7522 _pdbx_refine_tls.origin_z 26.6841 _pdbx_refine_tls.T[1][1] 0.0669 _pdbx_refine_tls.T[2][2] 0.0121 _pdbx_refine_tls.T[3][3] 0.0420 _pdbx_refine_tls.T[1][2] 0.0016 _pdbx_refine_tls.T[1][3] 0.0125 _pdbx_refine_tls.T[2][3] -0.0037 _pdbx_refine_tls.L[1][1] 1.3322 _pdbx_refine_tls.L[2][2] 0.2667 _pdbx_refine_tls.L[3][3] 0.7501 _pdbx_refine_tls.L[1][2] -0.1006 _pdbx_refine_tls.L[1][3] 0.7346 _pdbx_refine_tls.L[2][3] -0.1981 _pdbx_refine_tls.S[1][1] 0.0267 _pdbx_refine_tls.S[1][2] 0.0878 _pdbx_refine_tls.S[1][3] 0.0395 _pdbx_refine_tls.S[2][1] -0.0889 _pdbx_refine_tls.S[2][2] -0.0104 _pdbx_refine_tls.S[2][3] -0.0256 _pdbx_refine_tls.S[3][1] 0.0342 _pdbx_refine_tls.S[3][2] 0.0692 _pdbx_refine_tls.S[3][3] -0.0163 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 130 _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 130 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.1.24 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SOLVE phasing . ? 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 131 ? A GLY 131 2 1 Y 1 A ALA 132 ? A ALA 132 3 1 Y 1 A ARG 133 ? A ARG 133 4 1 Y 1 A GLY 134 ? A GLY 134 5 1 Y 1 A GLU 135 ? A GLU 135 6 1 Y 1 A THR 136 ? A THR 136 7 1 Y 1 A ARG 137 ? A ARG 137 8 1 Y 1 A GLY 138 ? A GLY 138 9 1 Y 1 A VAL 139 ? A VAL 139 10 1 Y 1 A LEU 140 ? A LEU 140 11 1 Y 1 A GLU 141 ? A GLU 141 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #