data_2D9K # _entry.id 2D9K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2D9K pdb_00002d9k 10.2210/pdb2d9k/pdb RCSB RCSB025155 ? ? WWPDB D_1000025155 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002004990.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2D9K _pdbx_database_status.recvd_initial_deposition_date 2005-12-10 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Suetake, T.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the zf-TRAF domain of FLN29 gene product' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Suetake, T.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'FLN29 gene product' 7996.945 1 ? ? 'zf-TRAF domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGHEETECPLRLAVCQHCDLELSILKLKEHEDYCGARTELCGNCGRNVLVKDLKTHPEVCGREGSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGHEETECPLRLAVCQHCDLELSILKLKEHEDYCGARTELCGNCGRNVLVKDLKTHPEVCGREGSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002004990.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 HIS n 1 9 GLU n 1 10 GLU n 1 11 THR n 1 12 GLU n 1 13 CYS n 1 14 PRO n 1 15 LEU n 1 16 ARG n 1 17 LEU n 1 18 ALA n 1 19 VAL n 1 20 CYS n 1 21 GLN n 1 22 HIS n 1 23 CYS n 1 24 ASP n 1 25 LEU n 1 26 GLU n 1 27 LEU n 1 28 SER n 1 29 ILE n 1 30 LEU n 1 31 LYS n 1 32 LEU n 1 33 LYS n 1 34 GLU n 1 35 HIS n 1 36 GLU n 1 37 ASP n 1 38 TYR n 1 39 CYS n 1 40 GLY n 1 41 ALA n 1 42 ARG n 1 43 THR n 1 44 GLU n 1 45 LEU n 1 46 CYS n 1 47 GLY n 1 48 ASN n 1 49 CYS n 1 50 GLY n 1 51 ARG n 1 52 ASN n 1 53 VAL n 1 54 LEU n 1 55 VAL n 1 56 LYS n 1 57 ASP n 1 58 LEU n 1 59 LYS n 1 60 THR n 1 61 HIS n 1 62 PRO n 1 63 GLU n 1 64 VAL n 1 65 CYS n 1 66 GLY n 1 67 ARG n 1 68 GLU n 1 69 GLY n 1 70 SER n 1 71 GLY n 1 72 PRO n 1 73 SER n 1 74 SER n 1 75 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'fln29, FLN29' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050111-12 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code NP_006691 _struct_ref.pdbx_db_accession 5729828 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code HEETECPLRLAVCQHCDLELSILKLKEHEDYCGARTELCGNCGRNVLVKDLKTHPEVCGREG _struct_ref.pdbx_align_begin 78 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2D9K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 69 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 5729828 _struct_ref_seq.db_align_beg 78 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 139 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 69 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2D9K GLY A 1 ? GB 5729828 ? ? 'cloning artifact' 1 1 1 2D9K SER A 2 ? GB 5729828 ? ? 'cloning artifact' 2 2 1 2D9K SER A 3 ? GB 5729828 ? ? 'cloning artifact' 3 3 1 2D9K GLY A 4 ? GB 5729828 ? ? 'cloning artifact' 4 4 1 2D9K SER A 5 ? GB 5729828 ? ? 'cloning artifact' 5 5 1 2D9K SER A 6 ? GB 5729828 ? ? 'cloning artifact' 6 6 1 2D9K GLY A 7 ? GB 5729828 ? ? 'cloning artifact' 7 7 1 2D9K SER A 70 ? GB 5729828 ? ? 'cloning artifact' 70 8 1 2D9K GLY A 71 ? GB 5729828 ? ? 'cloning artifact' 71 9 1 2D9K PRO A 72 ? GB 5729828 ? ? 'cloning artifact' 72 10 1 2D9K SER A 73 ? GB 5729828 ? ? 'cloning artifact' 73 11 1 2D9K SER A 74 ? GB 5729828 ? ? 'cloning artifact' 74 12 1 2D9K GLY A 75 ? GB 5729828 ? ? 'cloning artifact' 75 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.36mM 13C, 15N-labeled protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZnCl2; 1mM IDA' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2D9K _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2D9K _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violation, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2D9K _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C VARIAN 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2D9K _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2D9K _struct.title 'Solution structure of the zf-TRAF domain of FLN29 gene product' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2D9K _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text ;FLN29, zinc finger, zf-TRAF, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, IMMUNE SYSTEM ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 28 ? ARG A 42 ? SER A 28 ARG A 42 1 ? 15 HELX_P HELX_P2 2 LYS A 56 ? LYS A 59 ? LYS A 56 LYS A 59 5 ? 4 HELX_P HELX_P3 3 THR A 60 ? CYS A 65 ? THR A 60 CYS A 65 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 20 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 20 A ZN 401 1_555 ? ? ? ? ? ? ? 2.299 ? ? metalc2 metalc ? ? A CYS 23 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 23 A ZN 401 1_555 ? ? ? ? ? ? ? 2.346 ? ? metalc3 metalc ? ? A HIS 35 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 35 A ZN 401 1_555 ? ? ? ? ? ? ? 1.991 ? ? metalc4 metalc ? ? A CYS 39 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 39 A ZN 401 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc5 metalc ? ? A CYS 46 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 46 A ZN 601 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc6 metalc ? ? A CYS 49 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 49 A ZN 601 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc7 metalc ? ? A HIS 61 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 61 A ZN 601 1_555 ? ? ? ? ? ? ? 1.964 ? ? metalc8 metalc ? ? A CYS 65 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 65 A ZN 601 1_555 ? ? ? ? ? ? ? 2.350 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 18 ? VAL A 19 ? ALA A 18 VAL A 19 A 2 GLU A 26 ? LEU A 27 ? GLU A 26 LEU A 27 B 1 THR A 43 ? LEU A 45 ? THR A 43 LEU A 45 B 2 ASN A 52 ? LEU A 54 ? ASN A 52 LEU A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 18 ? N ALA A 18 O LEU A 27 ? O LEU A 27 B 1 2 N GLU A 44 ? N GLU A 44 O VAL A 53 ? O VAL A 53 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' AC2 Software A ZN 601 ? 4 'BINDING SITE FOR RESIDUE ZN A 601' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 20 ? CYS A 20 . ? 1_555 ? 2 AC1 4 CYS A 23 ? CYS A 23 . ? 1_555 ? 3 AC1 4 HIS A 35 ? HIS A 35 . ? 1_555 ? 4 AC1 4 CYS A 39 ? CYS A 39 . ? 1_555 ? 5 AC2 4 CYS A 46 ? CYS A 46 . ? 1_555 ? 6 AC2 4 CYS A 49 ? CYS A 49 . ? 1_555 ? 7 AC2 4 HIS A 61 ? HIS A 61 . ? 1_555 ? 8 AC2 4 CYS A 65 ? CYS A 65 . ? 1_555 ? # _database_PDB_matrix.entry_id 2D9K _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2D9K _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLY 75 75 75 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 401 401 ZN ZN A . C 2 ZN 1 601 601 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 20 ? A CYS 20 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 23 ? A CYS 23 ? 1_555 106.2 ? 2 SG ? A CYS 20 ? A CYS 20 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 112.7 ? 3 SG ? A CYS 23 ? A CYS 23 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 107.5 ? 4 SG ? A CYS 20 ? A CYS 20 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 104.5 ? 5 SG ? A CYS 23 ? A CYS 23 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 110.6 ? 6 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 115.0 ? 7 SG ? A CYS 46 ? A CYS 46 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 103.9 ? 8 SG ? A CYS 46 ? A CYS 46 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 NE2 ? A HIS 61 ? A HIS 61 ? 1_555 109.4 ? 9 SG ? A CYS 49 ? A CYS 49 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 NE2 ? A HIS 61 ? A HIS 61 ? 1_555 113.3 ? 10 SG ? A CYS 46 ? A CYS 46 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 SG ? A CYS 65 ? A CYS 65 ? 1_555 111.2 ? 11 SG ? A CYS 49 ? A CYS 49 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 SG ? A CYS 65 ? A CYS 65 ? 1_555 102.9 ? 12 NE2 ? A HIS 61 ? A HIS 61 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 SG ? A CYS 65 ? A CYS 65 ? 1_555 115.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-10 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 4 'Structure model' '_struct_ref_seq_dif.details' 17 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 14 ? ? -69.74 98.19 2 1 PRO A 72 ? ? -69.77 88.54 3 2 PRO A 14 ? ? -69.78 6.97 4 2 LEU A 58 ? ? -34.83 -34.28 5 3 PRO A 14 ? ? -69.75 84.17 6 3 PRO A 72 ? ? -69.80 3.79 7 4 PRO A 72 ? ? -69.77 2.30 8 5 LEU A 58 ? ? -34.18 -36.18 9 6 LEU A 32 ? ? -37.71 -28.33 10 6 PRO A 72 ? ? -69.73 1.49 11 7 LEU A 58 ? ? -38.78 -27.52 12 8 ARG A 16 ? ? -57.26 105.90 13 8 LEU A 58 ? ? -36.84 -29.25 14 8 PRO A 72 ? ? -69.83 94.92 15 9 PRO A 14 ? ? -69.81 -172.57 16 10 LEU A 58 ? ? -37.98 -33.86 17 10 ARG A 67 ? ? -96.55 -61.19 18 10 PRO A 72 ? ? -69.79 2.71 19 11 GLU A 9 ? ? -54.03 177.77 20 11 ILE A 29 ? ? -39.81 -32.52 21 11 LYS A 33 ? ? -35.01 -39.40 22 12 PRO A 14 ? ? -69.77 95.08 23 12 LEU A 32 ? ? -33.34 -39.64 24 13 ALA A 41 ? ? -39.52 -33.34 25 13 ARG A 42 ? ? -54.69 178.79 26 13 PRO A 72 ? ? -69.74 3.24 27 14 ARG A 42 ? ? -51.97 172.52 28 14 LEU A 58 ? ? -34.33 -33.13 29 14 PRO A 72 ? ? -69.74 88.09 30 16 LEU A 58 ? ? -35.33 -31.29 31 17 LEU A 58 ? ? -36.87 -29.06 32 18 PRO A 14 ? ? -69.80 -174.47 33 18 LEU A 58 ? ? -49.47 -17.89 34 19 PRO A 14 ? ? -69.78 7.22 35 19 PRO A 72 ? ? -69.80 3.37 36 20 PRO A 14 ? ? -69.74 93.36 37 20 CYS A 39 ? ? -34.65 -35.96 38 20 LEU A 58 ? ? -39.70 -25.49 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #