data_2D9R # _entry.id 2D9R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2D9R RCSB RCSB025162 WWPDB D_1000025162 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC80749 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2D9R _pdbx_database_status.recvd_initial_deposition_date 2005-12-13 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Binkowski, T.A.' 1 'Hatzos, C.' 2 'Moy, S.' 3 'Collart, F.' 4 'Joachimiak, A.' 5 'Midwest Center for Structural Genomics (MCSG)' 6 # _citation.id primary _citation.title 'Conserved hypothetical protein PG0164 frpm Porphyromonas gingivalis [W83]' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Binkowski, T.A.' 1 primary 'Hatzos, C.' 2 primary 'Moy, S.' 3 primary 'Collart, F.' 4 primary 'Joachimiak, A.' 5 # _cell.entry_id 2D9R _cell.length_a 50.631 _cell.length_b 50.631 _cell.length_c 68.651 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2D9R _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'conserved hypothetical protein' 11611.918 1 ? ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 3 non-polymer syn BETA-MERCAPTOETHANOL 78.133 1 ? ? ? ? 4 water nat water 18.015 79 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)KKTLPKTEAPSSVGNGSDSPIEFDAIIRQVPD(MSE)DAAYVEIPFDVKTVYGKGRVRVNATFDGYPYTGYIVR (MSE)GLPCHILGLRQDIRRAIGKQPGDSVYVTLLPL ; _entity_poly.pdbx_seq_one_letter_code_can ;MKKTLPKTEAPSSVGNGSDSPIEFDAIIRQVPDMDAAYVEIPFDVKTVYGKGRVRVNATFDGYPYTGYIVRMGLPCHILG LRQDIRRAIGKQPGDSVYVTLLPL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC80749 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 LYS n 1 3 LYS n 1 4 THR n 1 5 LEU n 1 6 PRO n 1 7 LYS n 1 8 THR n 1 9 GLU n 1 10 ALA n 1 11 PRO n 1 12 SER n 1 13 SER n 1 14 VAL n 1 15 GLY n 1 16 ASN n 1 17 GLY n 1 18 SER n 1 19 ASP n 1 20 SER n 1 21 PRO n 1 22 ILE n 1 23 GLU n 1 24 PHE n 1 25 ASP n 1 26 ALA n 1 27 ILE n 1 28 ILE n 1 29 ARG n 1 30 GLN n 1 31 VAL n 1 32 PRO n 1 33 ASP n 1 34 MSE n 1 35 ASP n 1 36 ALA n 1 37 ALA n 1 38 TYR n 1 39 VAL n 1 40 GLU n 1 41 ILE n 1 42 PRO n 1 43 PHE n 1 44 ASP n 1 45 VAL n 1 46 LYS n 1 47 THR n 1 48 VAL n 1 49 TYR n 1 50 GLY n 1 51 LYS n 1 52 GLY n 1 53 ARG n 1 54 VAL n 1 55 ARG n 1 56 VAL n 1 57 ASN n 1 58 ALA n 1 59 THR n 1 60 PHE n 1 61 ASP n 1 62 GLY n 1 63 TYR n 1 64 PRO n 1 65 TYR n 1 66 THR n 1 67 GLY n 1 68 TYR n 1 69 ILE n 1 70 VAL n 1 71 ARG n 1 72 MSE n 1 73 GLY n 1 74 LEU n 1 75 PRO n 1 76 CYS n 1 77 HIS n 1 78 ILE n 1 79 LEU n 1 80 GLY n 1 81 LEU n 1 82 ARG n 1 83 GLN n 1 84 ASP n 1 85 ILE n 1 86 ARG n 1 87 ARG n 1 88 ALA n 1 89 ILE n 1 90 GLY n 1 91 LYS n 1 92 GLN n 1 93 PRO n 1 94 GLY n 1 95 ASP n 1 96 SER n 1 97 VAL n 1 98 TYR n 1 99 VAL n 1 100 THR n 1 101 LEU n 1 102 LEU n 1 103 PRO n 1 104 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Porphyromonas _entity_src_gen.pdbx_gene_src_gene PG0164 _entity_src_gen.gene_src_species 'Porphyromonas gingivalis' _entity_src_gen.gene_src_strain W83 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Porphyromonas gingivalis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 242619 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code AAQ65404 _struct_ref.pdbx_db_accession 34396337 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKKTLPKTEAPSSVGNGSDSPIEFDAIIRQVPDMDAAYVEIPFDVKTVYGKGRVRVNATFDGYPYTGYIVRMGLPCHILG LRQDIRRAIGKQPGDSVYVTLLPL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2D9R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 34396337 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 104 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 104 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2D9R MSE A 1 ? GB 34396337 MET 1 'MODIFIED RESIDUE' 1 1 1 2D9R MSE A 34 ? GB 34396337 MET 34 'MODIFIED RESIDUE' 34 2 1 2D9R MSE A 72 ? GB 34396337 MET 72 'MODIFIED RESIDUE' 72 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BME non-polymer . BETA-MERCAPTOETHANOL ? 'C2 H6 O S' 78.133 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2D9R _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.19 _exptl_crystal.density_percent_sol 43.73 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pdbx_details '2M NaCl, 0.1M Citric Acid, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 150 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type SBC _diffrn_detector.pdbx_collection_date 2005-07-22 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97940 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-BM _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97940 # _reflns.entry_id 2D9R _reflns.observed_criterion_sigma_I 2 _reflns.observed_criterion_sigma_F 2 _reflns.d_resolution_low 43.85 _reflns.d_resolution_high 2.01 _reflns.number_obs 6774 _reflns.number_all 6815 _reflns.percent_possible_obs 99.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.01 _reflns_shell.d_res_low 2.08 _reflns_shell.percent_possible_all 99.42 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2D9R _refine.ls_number_reflns_obs 6774 _refine.ls_number_reflns_all 6815 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27 _refine.ls_d_res_high 2.01 _refine.ls_percent_reflns_obs 99.65 _refine.ls_R_factor_obs 0.1783 _refine.ls_R_factor_all 0.18045 _refine.ls_R_factor_R_work 0.17829 _refine.ls_R_factor_R_free 0.22715 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.7 _refine.ls_number_reflns_R_free 335 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.952 _refine.correlation_coeff_Fo_to_Fc_free 0.921 _refine.B_iso_mean 20.940 _refine.aniso_B[1][1] 1.09 _refine.aniso_B[2][2] 1.09 _refine.aniso_B[3][3] -1.63 _refine.aniso_B[1][2] 0.54 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.164 _refine.pdbx_overall_ESU_R_Free 0.155 _refine.overall_SU_ML 0.088 _refine.overall_SU_B 3.043 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 671 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 79 _refine_hist.number_atoms_total 756 _refine_hist.d_res_high 2.01 _refine_hist.d_res_low 27 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.017 0.022 ? 697 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.847 1.987 ? 947 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 13.485 5.000 ? 86 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 22.839 22.258 ? 31 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.506 15.000 ? 113 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 24.969 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.163 0.200 ? 105 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 534 'X-RAY DIFFRACTION' ? r_nbd_refined 0.241 0.200 ? 290 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.310 0.200 ? 485 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.185 0.200 ? 58 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.372 0.200 ? 36 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.425 0.200 ? 19 'X-RAY DIFFRACTION' ? r_mcbond_it 1.132 1.500 ? 441 'X-RAY DIFFRACTION' ? r_mcangle_it 1.720 2.000 ? 696 'X-RAY DIFFRACTION' ? r_scbond_it 2.817 3.000 ? 295 'X-RAY DIFFRACTION' ? r_scangle_it 4.108 4.500 ? 250 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.010 _refine_ls_shell.d_res_low 2.062 _refine_ls_shell.number_reflns_R_work 491 _refine_ls_shell.R_factor_R_work 0.194 _refine_ls_shell.percent_reflns_obs 99.42 _refine_ls_shell.R_factor_R_free 0.2 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 23 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2D9R _struct.title 'Structure of Conserved Protein of Unknown Function PG0164 from Porphyromonas gingivalis [W83]' _struct.pdbx_descriptor 'conserved hypothetical protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2D9R _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;MCSG, structural genomics, Porphyromonas gingivalis, hypothetical protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 44 ? GLY A 50 ? ASP A 44 GLY A 50 1 ? 7 HELX_P HELX_P2 2 ARG A 82 ? GLY A 90 ? ARG A 82 GLY A 90 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? D BME . S2 ? ? ? 1_555 A CYS 76 SG ? ? A BME 1270 A CYS 76 1_555 ? ? ? ? ? ? ? 2.178 ? covale2 covale ? ? A ASP 33 C ? ? ? 1_555 A MSE 34 N ? ? A ASP 33 A MSE 34 1_555 ? ? ? ? ? ? ? 1.328 ? covale3 covale ? ? A MSE 34 C ? ? ? 1_555 A ASP 35 N ? ? A MSE 34 A ASP 35 1_555 ? ? ? ? ? ? ? 1.327 ? covale4 covale ? ? A ARG 71 C ? ? ? 1_555 A MSE 72 N ? ? A ARG 71 A MSE 72 1_555 ? ? ? ? ? ? ? 1.315 ? covale5 covale ? ? A MSE 72 C ? ? ? 1_555 A GLY 73 N ? ? A MSE 72 A GLY 73 1_555 ? ? ? ? ? ? ? 1.311 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 74 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 74 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 75 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 75 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.26 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 22 ? ILE A 27 ? ILE A 22 ILE A 27 A 2 SER A 96 ? PRO A 103 ? SER A 96 PRO A 103 A 3 VAL A 54 ? PHE A 60 ? VAL A 54 PHE A 60 A 4 TYR A 63 ? ARG A 71 ? TYR A 63 ARG A 71 A 5 HIS A 77 ? LEU A 81 ? HIS A 77 LEU A 81 A 6 ALA A 37 ? GLU A 40 ? ALA A 37 GLU A 40 A 7 ARG A 29 ? GLN A 30 ? ARG A 29 GLN A 30 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 24 ? N PHE A 24 O VAL A 99 ? O VAL A 99 A 2 3 O LEU A 102 ? O LEU A 102 N ASN A 57 ? N ASN A 57 A 3 4 N ALA A 58 ? N ALA A 58 O TYR A 65 ? O TYR A 65 A 4 5 N VAL A 70 ? N VAL A 70 O ILE A 78 ? O ILE A 78 A 5 6 O LEU A 81 ? O LEU A 81 N ALA A 37 ? N ALA A 37 A 6 7 O TYR A 38 ? O TYR A 38 N ARG A 29 ? N ARG A 29 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 105' AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 106' AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE BME A 1270' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 PHE A 43 ? PHE A 43 . ? 1_555 ? 2 AC1 3 ASP A 44 ? ASP A 44 . ? 6_555 ? 3 AC1 3 ASP A 44 ? ASP A 44 . ? 1_555 ? 4 AC2 2 ARG A 53 ? ARG A 53 . ? 1_555 ? 5 AC2 2 ARG A 71 ? ARG A 71 . ? 1_555 ? 6 AC3 3 TYR A 38 ? TYR A 38 . ? 1_555 ? 7 AC3 3 GLU A 40 ? GLU A 40 . ? 1_555 ? 8 AC3 3 CYS A 76 ? CYS A 76 . ? 1_555 ? # _database_PDB_matrix.entry_id 2D9R _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2D9R _atom_sites.fract_transf_matrix[1][1] 0.019751 _atom_sites.fract_transf_matrix[1][2] 0.011403 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022806 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014566 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 LEU 5 5 ? ? ? A . n A 1 6 PRO 6 6 ? ? ? A . n A 1 7 LYS 7 7 ? ? ? A . n A 1 8 THR 8 8 ? ? ? A . n A 1 9 GLU 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 PRO 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 SER 13 13 ? ? ? A . n A 1 14 VAL 14 14 ? ? ? A . n A 1 15 GLY 15 15 ? ? ? A . n A 1 16 ASN 16 16 ? ? ? A . n A 1 17 GLY 17 17 ? ? ? A . n A 1 18 SER 18 18 ? ? ? A . n A 1 19 ASP 19 19 ? ? ? A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 MSE 34 34 34 MSE MSE A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 MSE 72 72 72 MSE MSE A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 LEU 104 104 104 LEU LEU A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 34 A MSE 34 ? MET SELENOMETHIONINE 2 A MSE 72 A MSE 72 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id CL _pdbx_struct_special_symmetry.auth_seq_id 105 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id CL _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-01-24 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0005 ? 1 SBC-Collect 'data collection' . ? 2 HKL-2000 'data scaling' . ? 3 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 N A GLY 73 ? ? 1_555 O A HOH 1298 ? ? 4_555 1.65 2 1 O A HOH 1298 ? ? 1_555 O A HOH 1298 ? ? 4_555 1.70 3 1 O A HOH 1287 ? ? 1_555 O A HOH 1344 ? ? 4_555 1.87 4 1 O A HOH 1316 ? ? 1_555 O A HOH 1344 ? ? 4_555 2.17 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 MSE _pdbx_validate_rmsd_angle.auth_seq_id_1 72 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 MSE _pdbx_validate_rmsd_angle.auth_seq_id_2 72 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 MSE _pdbx_validate_rmsd_angle.auth_seq_id_3 72 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 122.59 _pdbx_validate_rmsd_angle.angle_target_value 110.40 _pdbx_validate_rmsd_angle.angle_deviation 12.19 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.00 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 42 ? ? -88.06 34.43 2 1 MSE A 72 ? ? -104.28 -117.08 3 1 CYS A 76 ? ? -1.28 90.60 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 PRO _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 75 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 CYS _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 76 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 106.49 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A LEU 5 ? A LEU 5 6 1 Y 1 A PRO 6 ? A PRO 6 7 1 Y 1 A LYS 7 ? A LYS 7 8 1 Y 1 A THR 8 ? A THR 8 9 1 Y 1 A GLU 9 ? A GLU 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A PRO 11 ? A PRO 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A SER 13 ? A SER 13 14 1 Y 1 A VAL 14 ? A VAL 14 15 1 Y 1 A GLY 15 ? A GLY 15 16 1 Y 1 A ASN 16 ? A ASN 16 17 1 Y 1 A GLY 17 ? A GLY 17 18 1 Y 1 A SER 18 ? A SER 18 19 1 Y 1 A ASP 19 ? A ASP 19 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 BETA-MERCAPTOETHANOL BME 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 105 1 CL CL A . C 2 CL 1 106 2 CL CL A . D 3 BME 1 1270 1270 BME BME A . E 4 HOH 1 1271 5 HOH HOH A . E 4 HOH 2 1272 6 HOH HOH A . E 4 HOH 3 1273 7 HOH HOH A . E 4 HOH 4 1274 8 HOH HOH A . E 4 HOH 5 1275 9 HOH HOH A . E 4 HOH 6 1276 10 HOH HOH A . E 4 HOH 7 1277 11 HOH HOH A . E 4 HOH 8 1278 12 HOH HOH A . E 4 HOH 9 1279 13 HOH HOH A . E 4 HOH 10 1280 14 HOH HOH A . E 4 HOH 11 1281 16 HOH HOH A . E 4 HOH 12 1282 17 HOH HOH A . E 4 HOH 13 1283 18 HOH HOH A . E 4 HOH 14 1284 19 HOH HOH A . E 4 HOH 15 1285 20 HOH HOH A . E 4 HOH 16 1286 21 HOH HOH A . E 4 HOH 17 1287 22 HOH HOH A . E 4 HOH 18 1288 23 HOH HOH A . E 4 HOH 19 1289 25 HOH HOH A . E 4 HOH 20 1290 26 HOH HOH A . E 4 HOH 21 1291 27 HOH HOH A . E 4 HOH 22 1292 28 HOH HOH A . E 4 HOH 23 1293 29 HOH HOH A . E 4 HOH 24 1294 30 HOH HOH A . E 4 HOH 25 1295 31 HOH HOH A . E 4 HOH 26 1296 33 HOH HOH A . E 4 HOH 27 1297 34 HOH HOH A . E 4 HOH 28 1298 35 HOH HOH A . E 4 HOH 29 1299 37 HOH HOH A . E 4 HOH 30 1300 41 HOH HOH A . E 4 HOH 31 1301 43 HOH HOH A . E 4 HOH 32 1302 44 HOH HOH A . E 4 HOH 33 1303 45 HOH HOH A . E 4 HOH 34 1304 46 HOH HOH A . E 4 HOH 35 1305 47 HOH HOH A . E 4 HOH 36 1306 48 HOH HOH A . E 4 HOH 37 1307 49 HOH HOH A . E 4 HOH 38 1308 50 HOH HOH A . E 4 HOH 39 1309 51 HOH HOH A . E 4 HOH 40 1310 52 HOH HOH A . E 4 HOH 41 1311 53 HOH HOH A . E 4 HOH 42 1312 54 HOH HOH A . E 4 HOH 43 1313 55 HOH HOH A . E 4 HOH 44 1314 57 HOH HOH A . E 4 HOH 45 1315 58 HOH HOH A . E 4 HOH 46 1316 60 HOH HOH A . E 4 HOH 47 1317 61 HOH HOH A . E 4 HOH 48 1318 62 HOH HOH A . E 4 HOH 49 1319 63 HOH HOH A . E 4 HOH 50 1320 64 HOH HOH A . E 4 HOH 51 1321 65 HOH HOH A . E 4 HOH 52 1322 70 HOH HOH A . E 4 HOH 53 1323 71 HOH HOH A . E 4 HOH 54 1324 72 HOH HOH A . E 4 HOH 55 1325 73 HOH HOH A . E 4 HOH 56 1326 74 HOH HOH A . E 4 HOH 57 1327 75 HOH HOH A . E 4 HOH 58 1328 76 HOH HOH A . E 4 HOH 59 1329 77 HOH HOH A . E 4 HOH 60 1330 78 HOH HOH A . E 4 HOH 61 1331 79 HOH HOH A . E 4 HOH 62 1332 81 HOH HOH A . E 4 HOH 63 1333 83 HOH HOH A . E 4 HOH 64 1334 84 HOH HOH A . E 4 HOH 65 1335 85 HOH HOH A . E 4 HOH 66 1336 86 HOH HOH A . E 4 HOH 67 1337 87 HOH HOH A . E 4 HOH 68 1338 94 HOH HOH A . E 4 HOH 69 1339 95 HOH HOH A . E 4 HOH 70 1340 98 HOH HOH A . E 4 HOH 71 1341 101 HOH HOH A . E 4 HOH 72 1342 102 HOH HOH A . E 4 HOH 73 1343 103 HOH HOH A . E 4 HOH 74 1344 104 HOH HOH A . E 4 HOH 75 1345 105 HOH HOH A . E 4 HOH 76 1346 106 HOH HOH A . E 4 HOH 77 1347 107 HOH HOH A . E 4 HOH 78 1348 108 HOH HOH A . E 4 HOH 79 1349 109 HOH HOH A . #