data_2D9U # _entry.id 2D9U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2D9U RCSB RCSB025165 WWPDB D_1000025165 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2D9U _pdbx_database_status.recvd_initial_deposition_date 2005-12-13 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, H.' 1 'Saito, K.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the Chromo domain of chromobox homolog 2 from human' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Li, H.' 1 primary 'Saito, K.' 2 primary 'Koshiba, S.' 3 primary 'Inoue, M.' 4 primary 'Kigawa, T.' 5 primary 'Yokoyama, S.' 6 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Chromobox protein homolog 2 (isoform 2)' _entity.formula_weight 8370.388 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Chromo domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 GLN n 1 10 VAL n 1 11 PHE n 1 12 ALA n 1 13 ALA n 1 14 GLU n 1 15 CYS n 1 16 ILE n 1 17 LEU n 1 18 SER n 1 19 LYS n 1 20 ARG n 1 21 LEU n 1 22 ARG n 1 23 LYS n 1 24 GLY n 1 25 LYS n 1 26 LEU n 1 27 GLU n 1 28 TYR n 1 29 LEU n 1 30 VAL n 1 31 LYS n 1 32 TRP n 1 33 ARG n 1 34 GLY n 1 35 TRP n 1 36 SER n 1 37 SER n 1 38 LYS n 1 39 HIS n 1 40 ASN n 1 41 SER n 1 42 TRP n 1 43 GLU n 1 44 PRO n 1 45 GLU n 1 46 GLU n 1 47 ASN n 1 48 ILE n 1 49 LEU n 1 50 ASP n 1 51 PRO n 1 52 ARG n 1 53 LEU n 1 54 LEU n 1 55 LEU n 1 56 ALA n 1 57 PHE n 1 58 GLN n 1 59 LYS n 1 60 LYS n 1 61 GLU n 1 62 HIS n 1 63 GLU n 1 64 LYS n 1 65 GLU n 1 66 VAL n 1 67 GLN n 1 68 ASN n 1 69 SER n 1 70 GLY n 1 71 PRO n 1 72 SER n 1 73 SER n 1 74 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene CBX2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050613-29 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CBX2_HUMAN _struct_ref.pdbx_db_accession Q14781 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQN _struct_ref.pdbx_align_begin 9 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2D9U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14781 _struct_ref_seq.db_align_beg 9 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 69 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 68 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2D9U GLY A 1 ? UNP Q14781 ? ? 'CLONING ARTIFACT' 1 1 1 2D9U SER A 2 ? UNP Q14781 ? ? 'CLONING ARTIFACT' 2 2 1 2D9U SER A 3 ? UNP Q14781 ? ? 'CLONING ARTIFACT' 3 3 1 2D9U GLY A 4 ? UNP Q14781 ? ? 'CLONING ARTIFACT' 4 4 1 2D9U SER A 5 ? UNP Q14781 ? ? 'CLONING ARTIFACT' 5 5 1 2D9U SER A 6 ? UNP Q14781 ? ? 'CLONING ARTIFACT' 6 6 1 2D9U GLY A 7 ? UNP Q14781 ? ? 'CLONING ARTIFACT' 7 7 1 2D9U SER A 69 ? UNP Q14781 ? ? 'CLONING ARTIFACT' 69 8 1 2D9U GLY A 70 ? UNP Q14781 ? ? 'CLONING ARTIFACT' 70 9 1 2D9U PRO A 71 ? UNP Q14781 ? ? 'CLONING ARTIFACT' 71 10 1 2D9U SER A 72 ? UNP Q14781 ? ? 'CLONING ARTIFACT' 72 11 1 2D9U SER A 73 ? UNP Q14781 ? ? 'CLONING ARTIFACT' 73 12 1 2D9U GLY A 74 ? UNP Q14781 ? ? 'CLONING ARTIFACT' 74 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.11mM chromo domain U-15N, 13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O,10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2D9U _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2D9U _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2D9U _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XWINNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRview 5.0.4 'Johnson, B.A.' 3 'data analysis' Kujira 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2D9U _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2D9U _struct.title 'Solution structure of the Chromo domain of chromobox homolog 2 from human' _struct.pdbx_descriptor 'Chromobox protein homolog 2 (isoform 2)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2D9U _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;Chromobox homolog 2, chromo domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 45 ? ASN A 47 ? GLU A 45 ASN A 47 5 ? 3 HELX_P HELX_P2 2 PRO A 51 ? LYS A 64 ? PRO A 51 LYS A 64 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 13 ? ARG A 22 ? ALA A 13 ARG A 22 A 2 LYS A 25 ? TRP A 32 ? LYS A 25 TRP A 32 A 3 SER A 41 ? PRO A 44 ? SER A 41 PRO A 44 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 17 ? N LEU A 17 O LEU A 29 ? O LEU A 29 A 2 3 N TYR A 28 ? N TYR A 28 O GLU A 43 ? O GLU A 43 # _database_PDB_matrix.entry_id 2D9U _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2D9U _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 GLY 74 74 74 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-01-02 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX Determination Method: Author determined ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 13 ? ? -62.64 89.61 2 1 ASN A 40 ? ? -38.08 150.59 3 1 GLN A 58 ? ? -38.86 -39.79 4 1 VAL A 66 ? ? -130.03 -55.97 5 2 SER A 36 ? ? -47.36 -75.02 6 2 LYS A 38 ? ? -130.02 -39.31 7 2 GLN A 58 ? ? -38.53 -35.53 8 2 GLU A 65 ? ? -49.62 109.33 9 3 VAL A 10 ? ? -37.54 130.83 10 3 ALA A 12 ? ? -161.23 109.53 11 3 ARG A 22 ? ? -88.76 -74.99 12 3 LYS A 23 ? ? -127.34 -56.53 13 3 SER A 36 ? ? -42.27 152.50 14 3 LYS A 38 ? ? -37.15 -39.95 15 3 HIS A 39 ? ? -82.65 44.49 16 3 PRO A 71 ? ? -69.73 95.19 17 4 ARG A 22 ? ? -110.17 -72.00 18 4 SER A 36 ? ? -48.06 173.99 19 4 VAL A 66 ? ? -83.18 44.01 20 5 SER A 6 ? ? 37.16 44.27 21 5 ARG A 22 ? ? -121.67 -71.57 22 5 LEU A 29 ? ? -62.65 98.30 23 5 ARG A 33 ? ? -38.51 158.17 24 5 SER A 36 ? ? -53.69 -175.01 25 5 ASN A 40 ? ? -35.26 151.40 26 5 PRO A 71 ? ? -69.74 94.73 27 6 SER A 5 ? ? -68.56 94.08 28 6 GLN A 9 ? ? -162.19 111.08 29 6 VAL A 10 ? ? -36.15 133.19 30 6 ALA A 13 ? ? -68.47 99.24 31 6 ARG A 22 ? ? -173.68 130.60 32 6 SER A 36 ? ? -41.81 161.01 33 6 HIS A 39 ? ? -83.70 41.49 34 6 GLN A 67 ? ? -162.98 114.01 35 6 SER A 73 ? ? -61.44 84.98 36 7 ARG A 22 ? ? -119.45 -70.27 37 7 LEU A 29 ? ? -68.86 97.28 38 7 SER A 36 ? ? -55.76 -175.16 39 7 SER A 37 ? ? -84.92 36.83 40 7 HIS A 39 ? ? -80.03 46.32 41 7 ARG A 52 ? ? -39.80 -38.81 42 7 PRO A 71 ? ? -69.75 86.75 43 8 SER A 2 ? ? 36.30 42.40 44 8 ARG A 22 ? ? -119.37 -73.31 45 8 TRP A 35 ? ? -82.77 40.67 46 8 SER A 36 ? ? 34.42 37.85 47 8 LYS A 38 ? ? -130.42 -32.34 48 8 HIS A 39 ? ? -107.04 71.20 49 8 ARG A 52 ? ? -39.64 -38.19 50 8 ASN A 68 ? ? -68.82 82.87 51 8 SER A 69 ? ? -36.34 127.78 52 9 GLU A 8 ? ? -126.64 -56.46 53 9 GLN A 9 ? ? -96.01 39.16 54 9 VAL A 10 ? ? 34.05 43.88 55 9 PHE A 11 ? ? -57.43 109.56 56 9 ASN A 40 ? ? -34.51 150.93 57 9 PRO A 71 ? ? -69.76 96.87 58 9 SER A 72 ? ? -124.08 -56.67 59 10 ALA A 13 ? ? -60.96 81.17 60 10 ARG A 22 ? ? -82.83 48.17 61 10 HIS A 39 ? ? -111.61 78.37 62 10 GLN A 67 ? ? -172.83 132.88 63 11 ALA A 13 ? ? -63.87 95.10 64 11 ARG A 22 ? ? -130.14 -74.10 65 11 ARG A 33 ? ? -39.49 143.99 66 11 ASN A 40 ? ? -38.83 156.55 67 11 PRO A 71 ? ? -69.71 90.91 68 12 SER A 5 ? ? -58.95 97.45 69 12 ALA A 13 ? ? -63.58 82.14 70 12 ARG A 22 ? ? -120.56 -70.12 71 12 LEU A 29 ? ? -66.08 99.73 72 12 SER A 36 ? ? -55.31 -176.26 73 12 SER A 37 ? ? -83.63 37.08 74 12 HIS A 39 ? ? -85.35 46.11 75 13 SER A 3 ? ? -59.34 93.14 76 13 ALA A 13 ? ? -34.61 103.19 77 13 ARG A 22 ? ? -118.68 -74.83 78 13 LYS A 23 ? ? -103.89 77.38 79 13 SER A 36 ? ? -58.17 178.56 80 13 ASN A 40 ? ? -40.52 159.09 81 13 GLN A 67 ? ? -168.76 119.64 82 14 ALA A 12 ? ? -133.10 -32.43 83 14 ALA A 13 ? ? -33.52 93.75 84 14 ARG A 22 ? ? -96.50 -70.61 85 14 LYS A 23 ? ? -130.74 -60.47 86 14 ARG A 33 ? ? -45.11 159.83 87 14 ILE A 48 ? ? -66.18 99.88 88 15 VAL A 10 ? ? -37.48 134.41 89 15 TRP A 35 ? ? -101.26 -70.59 90 15 GLU A 65 ? ? -84.54 33.72 91 15 VAL A 66 ? ? 37.52 41.02 92 15 ASN A 68 ? ? -38.88 154.32 93 16 GLN A 9 ? ? -49.18 106.60 94 16 ARG A 22 ? ? -174.12 139.16 95 16 LEU A 29 ? ? -68.18 94.34 96 16 SER A 36 ? ? -44.37 159.33 97 16 HIS A 39 ? ? -92.52 45.68 98 16 GLN A 58 ? ? -39.07 -39.45 99 16 GLU A 65 ? ? -48.28 156.36 100 16 VAL A 66 ? ? -134.65 -42.25 101 16 SER A 72 ? ? 38.97 42.10 102 17 ALA A 13 ? ? -68.95 91.74 103 17 SER A 37 ? ? 38.38 46.35 104 17 LYS A 38 ? ? -125.71 -54.49 105 17 HIS A 39 ? ? -84.72 34.22 106 17 VAL A 66 ? ? -125.96 -54.97 107 17 GLN A 67 ? ? -37.04 149.39 108 18 VAL A 10 ? ? -80.72 43.18 109 18 ALA A 13 ? ? -55.05 102.62 110 18 SER A 36 ? ? -44.30 96.72 111 18 SER A 37 ? ? 34.29 46.92 112 18 HIS A 39 ? ? 33.91 36.97 113 19 SER A 3 ? ? -106.24 42.05 114 19 GLU A 8 ? ? -127.90 -53.47 115 19 ARG A 22 ? ? -123.17 -70.57 116 19 LYS A 23 ? ? -103.63 76.32 117 19 LEU A 29 ? ? -67.69 95.64 118 19 HIS A 39 ? ? -85.66 45.28 119 19 GLN A 58 ? ? -39.66 -39.92 120 19 ASN A 68 ? ? -130.75 -43.85 121 19 SER A 73 ? ? -99.49 42.15 122 20 SER A 6 ? ? -173.48 147.96 123 20 ALA A 13 ? ? -36.49 95.84 124 20 ARG A 22 ? ? -84.93 47.57 125 20 SER A 36 ? ? -48.04 171.20 126 20 HIS A 39 ? ? -83.51 45.42 #