data_2DA3 # _entry.id 2DA3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DA3 pdb_00002da3 10.2210/pdb2da3/pdb RCSB RCSB025174 ? ? WWPDB D_1000025174 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk003000131.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DA3 _pdbx_database_status.recvd_initial_deposition_date 2005-12-13 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ohnishi, S.' 1 'Kigawa, T.' 2 'Tomizawa, T.' 3 'Koshiba, S.' 4 'Inoue, M.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the third homeobox domain of AT-binding transcription factor 1 (ATBF1)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohnishi, S.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Tomizawa, T.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Inoue, M.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Alpha-fetoprotein enhancer binding protein' _entity.formula_weight 8982.086 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'The third homeobox domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AT motif-binding factor, AT-binding transcription factor 1, ATBF1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGGTGGEEPQRDKRLRTTITPEQLEILYQKYLLDSNPTRKMLDHIAHEVGLKKRVVQVWFQNTRARERKSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGGTGGEEPQRDKRLRTTITPEQLEILYQKYLLDSNPTRKMLDHIAHEVGLKKRVVQVWFQNTRARERKSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk003000131.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLY n 1 9 THR n 1 10 GLY n 1 11 GLY n 1 12 GLU n 1 13 GLU n 1 14 PRO n 1 15 GLN n 1 16 ARG n 1 17 ASP n 1 18 LYS n 1 19 ARG n 1 20 LEU n 1 21 ARG n 1 22 THR n 1 23 THR n 1 24 ILE n 1 25 THR n 1 26 PRO n 1 27 GLU n 1 28 GLN n 1 29 LEU n 1 30 GLU n 1 31 ILE n 1 32 LEU n 1 33 TYR n 1 34 GLN n 1 35 LYS n 1 36 TYR n 1 37 LEU n 1 38 LEU n 1 39 ASP n 1 40 SER n 1 41 ASN n 1 42 PRO n 1 43 THR n 1 44 ARG n 1 45 LYS n 1 46 MET n 1 47 LEU n 1 48 ASP n 1 49 HIS n 1 50 ILE n 1 51 ALA n 1 52 HIS n 1 53 GLU n 1 54 VAL n 1 55 GLY n 1 56 LEU n 1 57 LYS n 1 58 LYS n 1 59 ARG n 1 60 VAL n 1 61 VAL n 1 62 GLN n 1 63 VAL n 1 64 TRP n 1 65 PHE n 1 66 GLN n 1 67 ASN n 1 68 THR n 1 69 ARG n 1 70 ALA n 1 71 ARG n 1 72 GLU n 1 73 ARG n 1 74 LYS n 1 75 SER n 1 76 GLY n 1 77 PRO n 1 78 SER n 1 79 SER n 1 80 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ATBF1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050322-09 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATBF1_HUMAN _struct_ref.pdbx_db_accession Q15911 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GTGGEEPQRDKRLRTTITPEQLEILYQKYLLDSNPTRKMLDHIAHEVGLKKRVVQVWFQNTRARERK _struct_ref.pdbx_align_begin 2632 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DA3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 74 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q15911 _struct_ref_seq.db_align_beg 2632 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 2698 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 74 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DA3 GLY A 1 ? UNP Q15911 ? ? 'cloning artifact' 1 1 1 2DA3 SER A 2 ? UNP Q15911 ? ? 'cloning artifact' 2 2 1 2DA3 SER A 3 ? UNP Q15911 ? ? 'cloning artifact' 3 3 1 2DA3 GLY A 4 ? UNP Q15911 ? ? 'cloning artifact' 4 4 1 2DA3 SER A 5 ? UNP Q15911 ? ? 'cloning artifact' 5 5 1 2DA3 SER A 6 ? UNP Q15911 ? ? 'cloning artifact' 6 6 1 2DA3 GLY A 7 ? UNP Q15911 ? ? 'cloning artifact' 7 7 1 2DA3 SER A 75 ? UNP Q15911 ? ? 'cloning artifact' 75 8 1 2DA3 GLY A 76 ? UNP Q15911 ? ? 'cloning artifact' 76 9 1 2DA3 PRO A 77 ? UNP Q15911 ? ? 'cloning artifact' 77 10 1 2DA3 SER A 78 ? UNP Q15911 ? ? 'cloning artifact' 78 11 1 2DA3 SER A 79 ? UNP Q15911 ? ? 'cloning artifact' 79 12 1 2DA3 GLY A 80 ? UNP Q15911 ? ? 'cloning artifact' 80 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.1mM protein U-15N,13C; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DA3 _pdbx_nmr_refine.method 'torsion angle dynamics, restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DA3 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the lowest energy,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DA3 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DA3 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DA3 _struct.title 'Solution structure of the third homeobox domain of AT-binding transcription factor 1 (ATBF1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DA3 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;homeobox domain, three helices with the DNA binding helix-turn-helix motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 28 ? ASP A 39 ? GLN A 28 ASP A 39 1 ? 12 HELX_P HELX_P2 2 THR A 43 ? GLY A 55 ? THR A 43 GLY A 55 1 ? 13 HELX_P HELX_P3 3 LYS A 57 ? LYS A 74 ? LYS A 57 LYS A 74 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2DA3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DA3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 TRP 64 64 64 TRP TRP A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 GLY 80 80 80 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-13 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 13 ? ? -44.37 151.79 2 1 LYS A 18 ? ? -91.87 40.67 3 1 LYS A 57 ? ? -35.72 114.46 4 1 LYS A 74 ? ? -46.73 109.35 5 2 SER A 3 ? ? -130.45 -51.30 6 2 SER A 5 ? ? -174.82 134.30 7 2 GLN A 15 ? ? -42.91 107.73 8 2 THR A 23 ? ? -69.92 -176.04 9 2 ASP A 39 ? ? -163.05 112.52 10 3 SER A 5 ? ? -174.53 115.50 11 3 LEU A 20 ? ? -124.14 -73.37 12 3 THR A 23 ? ? -57.11 179.72 13 3 PRO A 42 ? ? -69.72 -177.66 14 3 LYS A 57 ? ? -36.86 130.03 15 4 SER A 5 ? ? 39.11 42.15 16 4 THR A 23 ? ? -48.74 178.76 17 4 LYS A 57 ? ? -37.74 121.75 18 4 LYS A 74 ? ? -82.88 45.13 19 4 SER A 79 ? ? -35.41 109.72 20 5 PRO A 14 ? ? -69.82 4.27 21 5 PRO A 77 ? ? -69.76 0.02 22 6 ASP A 17 ? ? -49.38 160.14 23 6 LYS A 18 ? ? -133.65 -57.30 24 6 LYS A 57 ? ? -38.24 124.31 25 6 LYS A 74 ? ? -56.14 101.00 26 6 PRO A 77 ? ? -69.78 99.30 27 7 ARG A 16 ? ? 39.24 41.35 28 7 ASP A 17 ? ? -36.20 114.10 29 7 LYS A 18 ? ? -91.75 40.15 30 8 LEU A 20 ? ? 33.97 54.55 31 8 ARG A 21 ? ? -49.14 166.23 32 8 THR A 23 ? ? -48.42 178.74 33 9 THR A 23 ? ? -47.40 175.50 34 9 PRO A 42 ? ? -69.77 -172.94 35 9 PRO A 77 ? ? -69.78 92.80 36 9 SER A 78 ? ? 70.98 34.41 37 10 SER A 5 ? ? -170.23 118.24 38 10 THR A 23 ? ? -54.65 175.08 39 10 LEU A 47 ? ? -39.97 -31.85 40 10 LYS A 57 ? ? -34.75 111.84 41 12 THR A 9 ? ? -170.06 128.52 42 12 ARG A 16 ? ? -63.99 98.18 43 12 LYS A 18 ? ? -124.41 -61.90 44 12 ARG A 21 ? ? -44.05 153.83 45 12 THR A 23 ? ? -53.76 176.74 46 12 LYS A 57 ? ? -37.78 125.23 47 12 LYS A 74 ? ? -42.66 156.55 48 12 PRO A 77 ? ? -69.75 1.98 49 13 PRO A 14 ? ? -69.77 4.28 50 13 GLN A 15 ? ? -69.63 97.61 51 13 LYS A 57 ? ? -39.40 115.06 52 13 LYS A 74 ? ? -37.91 122.09 53 14 THR A 9 ? ? -46.86 167.66 54 15 PRO A 77 ? ? -69.70 0.76 55 15 SER A 78 ? ? -68.52 86.64 56 16 SER A 3 ? ? -121.27 -54.35 57 16 SER A 5 ? ? -173.90 126.14 58 16 THR A 23 ? ? -59.14 174.81 59 16 PRO A 42 ? ? -69.73 -174.55 60 16 PRO A 77 ? ? -69.73 2.41 61 17 SER A 6 ? ? -126.04 -54.38 62 17 LYS A 18 ? ? -86.94 43.08 63 17 THR A 23 ? ? -50.52 -178.20 64 17 PRO A 42 ? ? -69.78 -177.67 65 17 LYS A 57 ? ? -36.89 119.41 66 17 LYS A 74 ? ? -38.38 107.08 67 17 SER A 78 ? ? -126.23 -56.05 68 18 GLN A 15 ? ? -91.19 39.56 69 18 LYS A 18 ? ? -96.22 -60.34 70 18 PRO A 42 ? ? -69.78 -173.73 71 18 LYS A 57 ? ? -36.25 115.18 72 18 TRP A 64 ? ? -39.92 -29.93 73 18 SER A 78 ? ? -42.96 166.32 74 18 SER A 79 ? ? 35.35 42.23 75 19 SER A 6 ? ? -39.55 125.69 76 19 PRO A 14 ? ? -69.85 4.38 77 19 THR A 23 ? ? -58.76 -178.84 78 19 LYS A 57 ? ? -37.60 124.19 79 19 PRO A 77 ? ? -69.75 1.00 80 20 ARG A 16 ? ? -45.50 170.95 81 20 ASP A 17 ? ? -161.07 115.11 82 20 LYS A 18 ? ? -98.73 40.30 83 20 THR A 23 ? ? -49.81 178.74 84 20 LYS A 57 ? ? -38.99 124.15 85 20 PRO A 77 ? ? -69.85 0.24 #