data_2DBK # _entry.id 2DBK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DBK pdb_00002dbk 10.2210/pdb2dbk/pdb RCSB RCSB025220 ? ? WWPDB D_1000025220 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DBK _pdbx_database_status.recvd_initial_deposition_date 2005-12-15 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sato, M.' 1 'Koshiba, S.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structures of the SH3 domain of human Crk-like protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sato, M.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Crk-like protein' _entity.formula_weight 9338.384 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDE NESGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDE NESGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 LEU n 1 10 PRO n 1 11 SER n 1 12 THR n 1 13 GLN n 1 14 ASN n 1 15 GLY n 1 16 PRO n 1 17 VAL n 1 18 PHE n 1 19 ALA n 1 20 LYS n 1 21 ALA n 1 22 ILE n 1 23 GLN n 1 24 LYS n 1 25 ARG n 1 26 VAL n 1 27 PRO n 1 28 CYS n 1 29 ALA n 1 30 TYR n 1 31 ASP n 1 32 LYS n 1 33 THR n 1 34 ALA n 1 35 LEU n 1 36 ALA n 1 37 LEU n 1 38 GLU n 1 39 VAL n 1 40 GLY n 1 41 ASP n 1 42 ILE n 1 43 VAL n 1 44 LYS n 1 45 VAL n 1 46 THR n 1 47 ARG n 1 48 MET n 1 49 ASN n 1 50 ILE n 1 51 ASN n 1 52 GLY n 1 53 GLN n 1 54 TRP n 1 55 GLU n 1 56 GLY n 1 57 GLU n 1 58 VAL n 1 59 ASN n 1 60 GLY n 1 61 ARG n 1 62 LYS n 1 63 GLY n 1 64 LEU n 1 65 PHE n 1 66 PRO n 1 67 PHE n 1 68 THR n 1 69 HIS n 1 70 VAL n 1 71 LYS n 1 72 ILE n 1 73 PHE n 1 74 ASP n 1 75 PRO n 1 76 GLN n 1 77 ASN n 1 78 PRO n 1 79 ASP n 1 80 GLU n 1 81 ASN n 1 82 GLU n 1 83 SER n 1 84 GLY n 1 85 PRO n 1 86 SER n 1 87 SER n 1 88 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene CRKL _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050207-02 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CRKL_HUMAN _struct_ref.pdbx_db_accession P46109 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE _struct_ref.pdbx_align_begin 229 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DBK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P46109 _struct_ref_seq.db_align_beg 229 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 303 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 82 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DBK GLY A 1 ? UNP P46109 ? ? 'cloning artifact' 1 1 1 2DBK SER A 2 ? UNP P46109 ? ? 'cloning artifact' 2 2 1 2DBK SER A 3 ? UNP P46109 ? ? 'cloning artifact' 3 3 1 2DBK GLY A 4 ? UNP P46109 ? ? 'cloning artifact' 4 4 1 2DBK SER A 5 ? UNP P46109 ? ? 'cloning artifact' 5 5 1 2DBK SER A 6 ? UNP P46109 ? ? 'cloning artifact' 6 6 1 2DBK GLY A 7 ? UNP P46109 ? ? 'cloning artifact' 7 7 1 2DBK SER A 83 ? UNP P46109 ? ? 'cloning artifact' 83 8 1 2DBK GLY A 84 ? UNP P46109 ? ? 'cloning artifact' 84 9 1 2DBK PRO A 85 ? UNP P46109 ? ? 'cloning artifact' 85 10 1 2DBK SER A 86 ? UNP P46109 ? ? 'cloning artifact' 86 11 1 2DBK SER A 87 ? UNP P46109 ? ? 'cloning artifact' 87 12 1 2DBK GLY A 88 ? UNP P46109 ? ? 'cloning artifact' 88 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1mM SH3 domain U-15N,13C; 20mM d-Tris HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DBK _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DBK _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DBK _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DBK _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DBK _struct.title 'Solution structures of the SH3 domain of human Crk-like protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DBK _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;CRKL, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 62 ? PHE A 65 ? LYS A 62 PHE A 65 A 2 TRP A 54 ? GLU A 57 ? TRP A 54 GLU A 57 A 3 ILE A 42 ? MET A 48 ? ILE A 42 MET A 48 A 4 VAL A 17 ? ALA A 21 ? VAL A 17 ALA A 21 A 5 VAL A 70 ? ILE A 72 ? VAL A 70 ILE A 72 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLY A 63 ? O GLY A 63 N GLY A 56 ? N GLY A 56 A 2 3 O GLU A 55 ? O GLU A 55 N ARG A 47 ? N ARG A 47 A 3 4 O VAL A 43 ? O VAL A 43 N ALA A 19 ? N ALA A 19 A 4 5 N LYS A 20 ? N LYS A 20 O LYS A 71 ? O LYS A 71 # _database_PDB_matrix.entry_id 2DBK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DBK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLY 88 88 88 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-12-19 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -34.63 119.09 2 1 LEU A 9 ? ? -48.54 153.60 3 1 SER A 11 ? ? -61.89 92.06 4 1 GLN A 76 ? ? -106.75 49.06 5 2 SER A 2 ? ? 37.16 41.91 6 2 GLN A 13 ? ? -84.76 44.11 7 2 LYS A 32 ? ? -96.09 38.52 8 2 VAL A 39 ? ? -36.70 107.77 9 2 PRO A 75 ? ? -69.80 2.76 10 2 GLN A 76 ? ? -79.79 44.03 11 3 VAL A 39 ? ? -40.23 107.38 12 3 GLN A 76 ? ? 36.18 49.81 13 3 PRO A 85 ? ? -69.77 0.66 14 4 PRO A 8 ? ? -69.70 -177.23 15 4 GLN A 13 ? ? -51.20 174.44 16 4 LYS A 32 ? ? 39.31 26.98 17 4 VAL A 39 ? ? -36.03 107.42 18 4 SER A 86 ? ? -102.60 -62.78 19 5 PRO A 8 ? ? -69.68 -175.91 20 5 PRO A 10 ? ? -69.70 93.00 21 5 ALA A 19 ? ? -162.65 117.93 22 5 CYS A 28 ? ? -56.90 170.84 23 5 VAL A 39 ? ? -47.87 107.00 24 5 GLN A 76 ? ? 35.00 39.46 25 6 PRO A 8 ? ? -69.72 -167.85 26 6 THR A 12 ? ? -55.05 102.27 27 6 VAL A 39 ? ? -39.24 113.26 28 6 GLN A 76 ? ? -92.69 53.27 29 6 ASN A 81 ? ? -51.79 106.31 30 7 SER A 11 ? ? -41.09 104.58 31 7 ASN A 14 ? ? -51.33 -177.12 32 7 TYR A 30 ? ? -104.83 41.82 33 7 VAL A 39 ? ? -41.63 109.13 34 7 GLN A 76 ? ? -91.37 52.89 35 8 SER A 3 ? ? -165.12 117.05 36 8 PRO A 8 ? ? -69.77 -165.90 37 8 PRO A 10 ? ? -69.67 86.69 38 8 ASN A 77 ? ? -32.61 96.10 39 9 SER A 11 ? ? -50.58 175.95 40 9 ASN A 59 ? ? 39.89 32.71 41 9 GLN A 76 ? ? -95.24 34.85 42 9 ASN A 77 ? ? -32.79 96.19 43 9 GLU A 80 ? ? -106.25 42.94 44 10 THR A 12 ? ? 39.43 39.70 45 10 ASN A 14 ? ? -39.24 114.41 46 10 VAL A 39 ? ? -40.65 109.54 47 10 PRO A 75 ? ? -69.74 2.63 48 10 GLN A 76 ? ? -79.13 47.36 49 10 PRO A 78 ? ? -69.79 1.56 50 10 ASP A 79 ? ? -108.28 -60.46 51 10 GLU A 82 ? ? -39.38 145.42 52 10 PRO A 85 ? ? -69.75 87.96 53 11 PRO A 8 ? ? -69.74 -172.87 54 11 THR A 12 ? ? -49.16 157.21 55 11 GLN A 13 ? ? -83.70 36.57 56 11 ASN A 59 ? ? 29.97 41.19 57 11 GLU A 80 ? ? -66.68 84.57 58 11 SER A 86 ? ? -47.53 103.36 59 12 PRO A 10 ? ? -69.70 -177.16 60 12 VAL A 39 ? ? -37.95 110.43 61 12 PRO A 75 ? ? -69.70 2.13 62 12 GLN A 76 ? ? -84.41 42.77 63 12 PRO A 85 ? ? -69.76 89.23 64 13 LEU A 9 ? ? -39.00 138.38 65 13 SER A 11 ? ? -172.72 141.93 66 13 VAL A 39 ? ? -34.69 113.47 67 13 ASN A 77 ? ? -32.63 96.07 68 13 PRO A 85 ? ? -69.77 89.50 69 13 SER A 86 ? ? -66.00 78.95 70 14 VAL A 39 ? ? -41.43 108.45 71 14 PRO A 75 ? ? -69.72 1.73 72 14 ASP A 79 ? ? -41.61 154.41 73 15 SER A 5 ? ? 36.59 45.45 74 16 VAL A 39 ? ? -40.74 108.70 75 16 PRO A 75 ? ? -69.82 2.08 76 16 GLN A 76 ? ? -80.28 48.32 77 16 GLU A 80 ? ? -61.81 80.58 78 17 SER A 3 ? ? 37.92 41.51 79 17 SER A 6 ? ? -43.13 158.25 80 17 ASP A 31 ? ? -66.51 97.91 81 17 VAL A 39 ? ? -36.01 109.07 82 17 ASN A 59 ? ? 49.22 25.34 83 17 PRO A 75 ? ? -69.73 1.94 84 17 PRO A 85 ? ? -69.81 -179.10 85 18 SER A 11 ? ? -37.27 137.15 86 18 VAL A 39 ? ? -36.73 113.21 87 18 ASN A 59 ? ? -31.19 91.48 88 18 GLN A 76 ? ? -78.30 46.28 89 18 PRO A 78 ? ? -69.75 2.63 90 18 GLU A 82 ? ? -161.33 115.49 91 18 SER A 86 ? ? 35.76 46.23 92 19 TYR A 30 ? ? -106.51 55.00 93 19 ILE A 50 ? ? -85.18 43.15 94 19 ASN A 51 ? ? -131.94 -38.77 95 19 GLN A 76 ? ? 38.51 46.51 96 20 VAL A 39 ? ? -33.88 106.07 97 20 ASN A 59 ? ? -33.70 99.23 98 20 GLN A 76 ? ? -98.02 44.32 99 20 ASN A 77 ? ? -32.68 96.05 100 20 SER A 87 ? ? -54.66 175.91 #