data_2DBS # _entry.id 2DBS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2DBS RCSB RCSB025227 WWPDB D_1000025227 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ttk003002175.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2DBS _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2005-12-16 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yoshikawa, S.' 1 'Arai, R.' 2 'Kamo-Uchikubo, T.' 3 'Fusatomi, E.' 4 'Akasaka, R.' 5 'Bessho, Y.' 6 'Murayama, K.' 7 'Terada, T.' 8 'Shirouzu, M.' 9 'Yokoyama, S.' 10 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 11 # _citation.id primary _citation.title 'Crystal structure of a hypothetical protein TTHC002 from Thermus thermophilus HB8' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Yoshikawa, S.' 1 primary 'Arai, R.' 2 primary 'Kamo-Uchikubo, T.' 3 primary 'Fusatomi, E.' 4 primary 'Akasaka, R.' 5 primary 'Bessho, Y.' 6 primary 'Murayama, K.' 7 primary 'Terada, T.' 8 primary 'Shirouzu, M.' 9 primary 'Yokoyama, S.' 10 # _cell.length_a 41.145 _cell.length_b 41.145 _cell.length_c 87.572 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.entry_id 2DBS _cell.pdbx_unique_axis ? _cell.Z_PDB 6 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 31' _symmetry.entry_id 2DBS _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 144 _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'hypothetical protein TTHC002' 10151.356 2 ? ? ? ? 2 water nat water 18.015 19 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)VNPAERLAELDGVL(MSE)QYLLEADLLRELPPTYRLVLLPLDEPEVAAQALAWA(MSE)EAPNPEGWPSVYALF LQGRPIRLLLLGKEVEVAPRAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MVNPAERLAELDGVLMQYLLEADLLRELPPTYRLVLLPLDEPEVAAQALAWAMEAPNPEGWPSVYALFLQGRPIRLLLLG KEVEVAPRAA ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ttk003002175.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 VAL n 1 3 ASN n 1 4 PRO n 1 5 ALA n 1 6 GLU n 1 7 ARG n 1 8 LEU n 1 9 ALA n 1 10 GLU n 1 11 LEU n 1 12 ASP n 1 13 GLY n 1 14 VAL n 1 15 LEU n 1 16 MSE n 1 17 GLN n 1 18 TYR n 1 19 LEU n 1 20 LEU n 1 21 GLU n 1 22 ALA n 1 23 ASP n 1 24 LEU n 1 25 LEU n 1 26 ARG n 1 27 GLU n 1 28 LEU n 1 29 PRO n 1 30 PRO n 1 31 THR n 1 32 TYR n 1 33 ARG n 1 34 LEU n 1 35 VAL n 1 36 LEU n 1 37 LEU n 1 38 PRO n 1 39 LEU n 1 40 ASP n 1 41 GLU n 1 42 PRO n 1 43 GLU n 1 44 VAL n 1 45 ALA n 1 46 ALA n 1 47 GLN n 1 48 ALA n 1 49 LEU n 1 50 ALA n 1 51 TRP n 1 52 ALA n 1 53 MSE n 1 54 GLU n 1 55 ALA n 1 56 PRO n 1 57 ASN n 1 58 PRO n 1 59 GLU n 1 60 GLY n 1 61 TRP n 1 62 PRO n 1 63 SER n 1 64 VAL n 1 65 TYR n 1 66 ALA n 1 67 LEU n 1 68 PHE n 1 69 LEU n 1 70 GLN n 1 71 GLY n 1 72 ARG n 1 73 PRO n 1 74 ILE n 1 75 ARG n 1 76 LEU n 1 77 LEU n 1 78 LEU n 1 79 LEU n 1 80 GLY n 1 81 LYS n 1 82 GLU n 1 83 VAL n 1 84 GLU n 1 85 VAL n 1 86 ALA n 1 87 PRO n 1 88 ARG n 1 89 ALA n 1 90 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermus _entity_src_gen.pdbx_gene_src_gene TTHC002 _entity_src_gen.gene_src_species 'Thermus thermophilus' _entity_src_gen.gene_src_strain HB8 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 300852 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'B834(DE3)pRARE' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5SGN2_THET8 _struct_ref.pdbx_db_accession Q5SGN2 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2DBS A 1 ? 90 ? Q5SGN2 1 ? 90 ? 1 90 2 1 2DBS B 1 ? 90 ? Q5SGN2 1 ? 90 ? 1 90 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DBS MSE A 1 ? UNP Q5SGN2 MET 1 'MODIFIED RESIDUE' 1 1 1 2DBS MSE A 16 ? UNP Q5SGN2 MET 16 'MODIFIED RESIDUE' 16 2 1 2DBS MSE A 53 ? UNP Q5SGN2 MET 53 'MODIFIED RESIDUE' 53 3 2 2DBS MSE B 1 ? UNP Q5SGN2 MET 1 'MODIFIED RESIDUE' 1 4 2 2DBS MSE B 16 ? UNP Q5SGN2 MET 16 'MODIFIED RESIDUE' 16 5 2 2DBS MSE B 53 ? UNP Q5SGN2 MET 53 'MODIFIED RESIDUE' 53 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2DBS _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.11 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 41.59 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '0.1M HEPES-Na, 1.25M Lithium Sulfate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RIGAKU JUPITER 210' _diffrn_detector.pdbx_collection_date 2005-04-16 _diffrn_detector.details 'Two dimensional focusing mirror' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.monochromator 'Si double crystal' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97924 1.0 2 0.97957 1.0 3 0.96000 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL26B1' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.97924, 0.97957, 0.96000' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL26B1 # _reflns.entry_id 2DBS _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 2.00 _reflns.number_obs 10858 _reflns.percent_possible_obs 96.800 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_chi_squared 1.017 _reflns.pdbx_redundancy 4.400 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_netI_over_sigmaI 13.1 _reflns.pdbx_Rsym_value 0.073 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3 _reflns.number_all ? _reflns.B_iso_Wilson_estimate 24.0 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_low 2.07 _reflns_shell.d_res_high 2.00 _reflns_shell.number_unique_all 912 _reflns_shell.percent_possible_all 80.700 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_chi_squared 1.011 _reflns_shell.pdbx_redundancy 3.200 _reflns_shell.number_unique_obs ? _reflns_shell.meanI_over_sigI_obs 3.05 _reflns_shell.pdbx_Rsym_value 0.246 _reflns_shell.percent_possible_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.ls_d_res_high 2.100 _refine.ls_d_res_low 36.000 _refine.pdbx_ls_sigma_F 0 _refine.ls_percent_reflns_obs 92.100 _refine.ls_number_reflns_obs 8908 _refine.ls_percent_reflns_R_free 9.690 _refine.ls_number_reflns_R_free 863 _refine.B_iso_mean 43.498 _refine.solvent_model_param_bsol 68.259 _refine.aniso_B[1][1] -6.762 _refine.aniso_B[2][2] -6.762 _refine.aniso_B[3][3] 13.524 _refine.aniso_B[1][2] -5.125 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.entry_id 2DBS _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_work 0.2561 _refine.ls_R_factor_R_free 0.2712 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF 0 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.354 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.details ;THIS IS A TWINNED STRUCTURE. THE TWINNING OPERATOR IS (H,K,L) -> (H,-H-K,-L) AND THE TWINNING FRACTION IS 0.467. THE R-FACTOR IS 0.2561 AND THE R-FREE IS 0.2712 WHEN THIS TWINNING OPERATOR IS USED. ; _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2DBS _refine_analyze.Luzzati_coordinate_error_obs 0.40 _refine_analyze.Luzzati_sigma_a_obs 0.51 _refine_analyze.Luzzati_d_res_low_obs 5.0 _refine_analyze.Luzzati_coordinate_error_free 0.42 _refine_analyze.Luzzati_sigma_a_free 0.50 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1280 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 1299 _refine_hist.d_res_high 2.100 _refine_hist.d_res_low 36.000 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.0108 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.997 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 24.37 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.918 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.207 1.500 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.150 2.000 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 1.511 2.000 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 2.412 2.500 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 2.10 _refine_ls_shell.d_res_low 2.20 _refine_ls_shell.number_reflns_obs 857 _refine_ls_shell.number_reflns_R_free 85 _refine_ls_shell.R_factor_R_work 0.3774 _refine_ls_shell.R_factor_R_free 0.3998 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_obs 71.2 _refine_ls_shell.percent_reflns_R_free 9.92 _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.number_reflns_R_work 772 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 2DBS _struct.title 'Crystal structure of a hypothetical protein TTHC002 from Thermus thermophilus HB8' _struct.pdbx_descriptor 'hypothetical protein TTHC002' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DBS _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;hypothetical protein, TT2175, TTHC002, extremely thermophilic bacteria, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 7 ? GLU A 21 ? ARG A 7 GLU A 21 1 ? 15 HELX_P HELX_P2 2 LEU A 24 ? LEU A 28 ? LEU A 24 LEU A 28 5 ? 5 HELX_P HELX_P3 3 GLU A 41 ? GLU A 54 ? GLU A 41 GLU A 54 1 ? 14 HELX_P HELX_P4 4 ARG B 7 ? GLU B 21 ? ARG B 7 GLU B 21 1 ? 15 HELX_P HELX_P5 5 LEU B 24 ? LEU B 28 ? LEU B 24 LEU B 28 5 ? 5 HELX_P HELX_P6 6 GLU B 41 ? GLU B 54 ? GLU B 41 GLU B 54 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A LEU 15 C ? ? ? 1_555 A MSE 16 N ? ? A LEU 15 A MSE 16 1_555 ? ? ? ? ? ? ? 1.325 ? covale2 covale ? ? A MSE 16 C ? ? ? 1_555 A GLN 17 N ? ? A MSE 16 A GLN 17 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? A ALA 52 C ? ? ? 1_555 A MSE 53 N ? ? A ALA 52 A MSE 53 1_555 ? ? ? ? ? ? ? 1.328 ? covale4 covale ? ? A MSE 53 C ? ? ? 1_555 A GLU 54 N ? ? A MSE 53 A GLU 54 1_555 ? ? ? ? ? ? ? 1.337 ? covale5 covale ? ? B LEU 15 C ? ? ? 1_555 B MSE 16 N ? ? B LEU 15 B MSE 16 1_555 ? ? ? ? ? ? ? 1.329 ? covale6 covale ? ? B MSE 16 C ? ? ? 1_555 B GLN 17 N ? ? B MSE 16 B GLN 17 1_555 ? ? ? ? ? ? ? 1.330 ? covale7 covale ? ? B ALA 52 C ? ? ? 1_555 B MSE 53 N ? ? B ALA 52 B MSE 53 1_555 ? ? ? ? ? ? ? 1.335 ? covale8 covale ? ? B MSE 53 C ? ? ? 1_555 B GLU 54 N ? ? B MSE 53 B GLU 54 1_555 ? ? ? ? ? ? ? 1.334 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 33 ? PRO A 38 ? ARG A 33 PRO A 38 A 2 SER A 63 ? LEU A 69 ? SER A 63 LEU A 69 A 3 ARG A 72 ? GLU A 84 ? ARG A 72 GLU A 84 A 4 ARG B 72 ? GLU B 84 ? ARG B 72 GLU B 84 A 5 SER B 63 ? LEU B 69 ? SER B 63 LEU B 69 A 6 ARG B 33 ? PRO B 38 ? ARG B 33 PRO B 38 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 35 ? N VAL A 35 O VAL A 64 ? O VAL A 64 A 2 3 N LEU A 67 ? N LEU A 67 O ILE A 74 ? O ILE A 74 A 3 4 N LYS A 81 ? N LYS A 81 O LEU B 78 ? O LEU B 78 A 4 5 O ILE B 74 ? O ILE B 74 N LEU B 67 ? N LEU B 67 A 5 6 O VAL B 64 ? O VAL B 64 N VAL B 35 ? N VAL B 35 # _atom_sites.entry_id 2DBS _atom_sites.fract_transf_matrix[1][1] 0.024304 _atom_sites.fract_transf_matrix[1][2] 0.014032 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.028064 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011419 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 VAL 2 2 ? ? ? A . n A 1 3 ASN 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 GLU 6 6 ? ? ? A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 MSE 16 16 16 MSE MSE A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 MSE 53 53 53 MSE MSE A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 PRO 87 87 ? ? ? A . n A 1 88 ARG 88 88 ? ? ? A . n A 1 89 ALA 89 89 ? ? ? A . n A 1 90 ALA 90 90 ? ? ? A . n B 1 1 MSE 1 1 ? ? ? B . n B 1 2 VAL 2 2 ? ? ? B . n B 1 3 ASN 3 3 ? ? ? B . n B 1 4 PRO 4 4 4 PRO PRO B . n B 1 5 ALA 5 5 5 ALA ALA B . n B 1 6 GLU 6 6 6 GLU GLU B . n B 1 7 ARG 7 7 7 ARG ARG B . n B 1 8 LEU 8 8 8 LEU LEU B . n B 1 9 ALA 9 9 9 ALA ALA B . n B 1 10 GLU 10 10 10 GLU GLU B . n B 1 11 LEU 11 11 11 LEU LEU B . n B 1 12 ASP 12 12 12 ASP ASP B . n B 1 13 GLY 13 13 13 GLY GLY B . n B 1 14 VAL 14 14 14 VAL VAL B . n B 1 15 LEU 15 15 15 LEU LEU B . n B 1 16 MSE 16 16 16 MSE MSE B . n B 1 17 GLN 17 17 17 GLN GLN B . n B 1 18 TYR 18 18 18 TYR TYR B . n B 1 19 LEU 19 19 19 LEU LEU B . n B 1 20 LEU 20 20 20 LEU LEU B . n B 1 21 GLU 21 21 21 GLU GLU B . n B 1 22 ALA 22 22 22 ALA ALA B . n B 1 23 ASP 23 23 23 ASP ASP B . n B 1 24 LEU 24 24 24 LEU LEU B . n B 1 25 LEU 25 25 25 LEU LEU B . n B 1 26 ARG 26 26 26 ARG ARG B . n B 1 27 GLU 27 27 27 GLU GLU B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 PRO 29 29 29 PRO PRO B . n B 1 30 PRO 30 30 30 PRO PRO B . n B 1 31 THR 31 31 31 THR THR B . n B 1 32 TYR 32 32 32 TYR TYR B . n B 1 33 ARG 33 33 33 ARG ARG B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 VAL 35 35 35 VAL VAL B . n B 1 36 LEU 36 36 36 LEU LEU B . n B 1 37 LEU 37 37 37 LEU LEU B . n B 1 38 PRO 38 38 38 PRO PRO B . n B 1 39 LEU 39 39 39 LEU LEU B . n B 1 40 ASP 40 40 40 ASP ASP B . n B 1 41 GLU 41 41 41 GLU GLU B . n B 1 42 PRO 42 42 42 PRO PRO B . n B 1 43 GLU 43 43 43 GLU GLU B . n B 1 44 VAL 44 44 44 VAL VAL B . n B 1 45 ALA 45 45 45 ALA ALA B . n B 1 46 ALA 46 46 46 ALA ALA B . n B 1 47 GLN 47 47 47 GLN GLN B . n B 1 48 ALA 48 48 48 ALA ALA B . n B 1 49 LEU 49 49 49 LEU LEU B . n B 1 50 ALA 50 50 50 ALA ALA B . n B 1 51 TRP 51 51 51 TRP TRP B . n B 1 52 ALA 52 52 52 ALA ALA B . n B 1 53 MSE 53 53 53 MSE MSE B . n B 1 54 GLU 54 54 54 GLU GLU B . n B 1 55 ALA 55 55 55 ALA ALA B . n B 1 56 PRO 56 56 56 PRO PRO B . n B 1 57 ASN 57 57 57 ASN ASN B . n B 1 58 PRO 58 58 58 PRO PRO B . n B 1 59 GLU 59 59 59 GLU GLU B . n B 1 60 GLY 60 60 60 GLY GLY B . n B 1 61 TRP 61 61 61 TRP TRP B . n B 1 62 PRO 62 62 62 PRO PRO B . n B 1 63 SER 63 63 63 SER SER B . n B 1 64 VAL 64 64 64 VAL VAL B . n B 1 65 TYR 65 65 65 TYR TYR B . n B 1 66 ALA 66 66 66 ALA ALA B . n B 1 67 LEU 67 67 67 LEU LEU B . n B 1 68 PHE 68 68 68 PHE PHE B . n B 1 69 LEU 69 69 69 LEU LEU B . n B 1 70 GLN 70 70 70 GLN GLN B . n B 1 71 GLY 71 71 71 GLY GLY B . n B 1 72 ARG 72 72 72 ARG ARG B . n B 1 73 PRO 73 73 73 PRO PRO B . n B 1 74 ILE 74 74 74 ILE ILE B . n B 1 75 ARG 75 75 75 ARG ARG B . n B 1 76 LEU 76 76 76 LEU LEU B . n B 1 77 LEU 77 77 77 LEU LEU B . n B 1 78 LEU 78 78 78 LEU LEU B . n B 1 79 LEU 79 79 79 LEU LEU B . n B 1 80 GLY 80 80 80 GLY GLY B . n B 1 81 LYS 81 81 81 LYS LYS B . n B 1 82 GLU 82 82 82 GLU GLU B . n B 1 83 VAL 83 83 83 VAL VAL B . n B 1 84 GLU 84 84 84 GLU GLU B . n B 1 85 VAL 85 85 85 VAL VAL B . n B 1 86 ALA 86 86 ? ? ? B . n B 1 87 PRO 87 87 ? ? ? B . n B 1 88 ARG 88 88 ? ? ? B . n B 1 89 ALA 89 89 ? ? ? B . n B 1 90 ALA 90 90 ? ? ? B . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 91 2 HOH HOH A . C 2 HOH 2 92 4 HOH HOH A . C 2 HOH 3 93 6 HOH HOH A . C 2 HOH 4 94 8 HOH HOH A . C 2 HOH 5 95 9 HOH HOH A . C 2 HOH 6 96 10 HOH HOH A . C 2 HOH 7 97 12 HOH HOH A . C 2 HOH 8 98 14 HOH HOH A . C 2 HOH 9 99 17 HOH HOH A . C 2 HOH 10 100 18 HOH HOH A . D 2 HOH 1 91 1 HOH HOH B . D 2 HOH 2 92 3 HOH HOH B . D 2 HOH 3 93 5 HOH HOH B . D 2 HOH 4 94 7 HOH HOH B . D 2 HOH 5 95 11 HOH HOH B . D 2 HOH 6 96 13 HOH HOH B . D 2 HOH 7 97 15 HOH HOH B . D 2 HOH 8 98 16 HOH HOH B . D 2 HOH 9 99 19 HOH HOH B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 16 A MSE 16 ? MET SELENOMETHIONINE 2 A MSE 53 A MSE 53 ? MET SELENOMETHIONINE 3 B MSE 16 B MSE 16 ? MET SELENOMETHIONINE 4 B MSE 53 B MSE 53 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2700 ? 1 MORE -23 ? 1 'SSA (A^2)' 8790 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-16 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.contact_author' 3 4 'Structure model' '_software.contact_author_email' 4 4 'Structure model' '_software.date' 5 4 'Structure model' '_software.language' 6 4 'Structure model' '_software.location' 7 4 'Structure model' '_software.name' 8 4 'Structure model' '_software.type' 9 4 'Structure model' '_software.version' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal DENZO . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data reduction' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data scaling' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 2 CNS . ? package 'Axel T. Brunger' axel.brunger@yale.edu refinement http://cns.csb.yale.edu/v1.1/ Fortran_77 ? 3 PDB_EXTRACT 1.701 'OCT. 28, 2005' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 4 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 5 SOLVE . ? ? ? ? phasing ? ? ? 6 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 ND2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASN _pdbx_validate_symm_contact.auth_seq_id_1 57 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 ALA _pdbx_validate_symm_contact.auth_seq_id_2 5 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 1_655 _pdbx_validate_symm_contact.dist 2.14 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A ALA 55 ? ? N A PRO 56 ? ? CA A PRO 56 ? ? 133.64 119.30 14.34 1.50 Y 2 1 C A ALA 55 ? ? N A PRO 56 ? ? CD A PRO 56 ? ? 102.70 128.40 -25.70 2.10 Y 3 1 C A ASN 57 ? ? N A PRO 58 ? ? CA A PRO 58 ? ? 135.77 119.30 16.47 1.50 Y 4 1 C A ASN 57 ? ? N A PRO 58 ? ? CD A PRO 58 ? ? 102.40 128.40 -26.00 2.10 Y 5 1 C B ASN 57 ? ? N B PRO 58 ? ? CA B PRO 58 ? ? 131.26 119.30 11.96 1.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 20 ? ? -79.20 -85.74 2 1 GLU A 21 ? ? -59.18 28.59 3 1 ALA A 22 ? ? -163.23 15.93 4 1 GLU A 54 ? ? -60.92 -161.74 5 1 PRO A 58 ? ? 47.68 -16.90 6 1 GLU A 59 ? ? -159.54 -135.01 7 1 GLU B 6 ? ? 169.74 -20.41 8 1 LEU B 20 ? ? -85.00 -80.86 9 1 GLU B 21 ? ? -68.55 36.87 10 1 ALA B 22 ? ? -160.59 15.21 11 1 GLU B 54 ? ? -77.65 31.42 12 1 ALA B 55 ? ? 176.62 79.70 13 1 PRO B 56 ? ? -71.62 -79.51 14 1 ASN B 57 ? ? 59.54 82.48 15 1 PRO B 58 ? ? -71.74 -96.69 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A VAL 2 ? A VAL 2 3 1 Y 1 A ASN 3 ? A ASN 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A GLU 6 ? A GLU 6 7 1 Y 1 A PRO 87 ? A PRO 87 8 1 Y 1 A ARG 88 ? A ARG 88 9 1 Y 1 A ALA 89 ? A ALA 89 10 1 Y 1 A ALA 90 ? A ALA 90 11 1 Y 1 B MSE 1 ? B MSE 1 12 1 Y 1 B VAL 2 ? B VAL 2 13 1 Y 1 B ASN 3 ? B ASN 3 14 1 Y 1 B ALA 86 ? B ALA 86 15 1 Y 1 B PRO 87 ? B PRO 87 16 1 Y 1 B ARG 88 ? B ARG 88 17 1 Y 1 B ALA 89 ? B ALA 89 18 1 Y 1 B ALA 90 ? B ALA 90 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #