data_2DK3 # _entry.id 2DK3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DK3 pdb_00002dk3 10.2210/pdb2dk3/pdb RCSB RCSB025508 ? ? WWPDB D_1000025508 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002101105.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DK3 _pdbx_database_status.recvd_initial_deposition_date 2006-04-06 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of Mib-herc2 domain in HECT domain containing protein 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'E3 ubiquitin-protein ligase HECTD1' _entity.formula_weight 9083.944 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Mib-herc2 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HECT domain-containing protein 1, E3 ligase for inhibin receptor, EULIR' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGVRSQVLKYMVPGARVIRGLDWKWRDQDGSPQGEGTVTGELHNGWIDVTWDAGGSNSYRMGAEGKFDLKLAPGY SGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGVRSQVLKYMVPGARVIRGLDWKWRDQDGSPQGEGTVTGELHNGWIDVTWDAGGSNSYRMGAEGKFDLKLAPGY SGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002101105.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 VAL n 1 9 ARG n 1 10 SER n 1 11 GLN n 1 12 VAL n 1 13 LEU n 1 14 LYS n 1 15 TYR n 1 16 MET n 1 17 VAL n 1 18 PRO n 1 19 GLY n 1 20 ALA n 1 21 ARG n 1 22 VAL n 1 23 ILE n 1 24 ARG n 1 25 GLY n 1 26 LEU n 1 27 ASP n 1 28 TRP n 1 29 LYS n 1 30 TRP n 1 31 ARG n 1 32 ASP n 1 33 GLN n 1 34 ASP n 1 35 GLY n 1 36 SER n 1 37 PRO n 1 38 GLN n 1 39 GLY n 1 40 GLU n 1 41 GLY n 1 42 THR n 1 43 VAL n 1 44 THR n 1 45 GLY n 1 46 GLU n 1 47 LEU n 1 48 HIS n 1 49 ASN n 1 50 GLY n 1 51 TRP n 1 52 ILE n 1 53 ASP n 1 54 VAL n 1 55 THR n 1 56 TRP n 1 57 ASP n 1 58 ALA n 1 59 GLY n 1 60 GLY n 1 61 SER n 1 62 ASN n 1 63 SER n 1 64 TYR n 1 65 ARG n 1 66 MET n 1 67 GLY n 1 68 ALA n 1 69 GLU n 1 70 GLY n 1 71 LYS n 1 72 PHE n 1 73 ASP n 1 74 LEU n 1 75 LYS n 1 76 LEU n 1 77 ALA n 1 78 PRO n 1 79 GLY n 1 80 TYR n 1 81 SER n 1 82 GLY n 1 83 PRO n 1 84 SER n 1 85 SER n 1 86 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'HECTD1, KIAA1131' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050719-02 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HECD1_HUMAN _struct_ref.pdbx_db_accession Q9ULT8 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1268 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DK3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 80 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9ULT8 _struct_ref_seq.db_align_beg 1268 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1340 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 80 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DK3 GLY A 1 ? UNP Q9ULT8 ? ? 'cloning artifact' 1 1 1 2DK3 SER A 2 ? UNP Q9ULT8 ? ? 'cloning artifact' 2 2 1 2DK3 SER A 3 ? UNP Q9ULT8 ? ? 'cloning artifact' 3 3 1 2DK3 GLY A 4 ? UNP Q9ULT8 ? ? 'cloning artifact' 4 4 1 2DK3 SER A 5 ? UNP Q9ULT8 ? ? 'cloning artifact' 5 5 1 2DK3 SER A 6 ? UNP Q9ULT8 ? ? 'cloning artifact' 6 6 1 2DK3 GLY A 7 ? UNP Q9ULT8 ? ? 'cloning artifact' 7 7 1 2DK3 SER A 81 ? UNP Q9ULT8 ? ? 'cloning artifact' 81 8 1 2DK3 GLY A 82 ? UNP Q9ULT8 ? ? 'cloning artifact' 82 9 1 2DK3 PRO A 83 ? UNP Q9ULT8 ? ? 'cloning artifact' 83 10 1 2DK3 SER A 84 ? UNP Q9ULT8 ? ? 'cloning artifact' 84 11 1 2DK3 SER A 85 ? UNP Q9ULT8 ? ? 'cloning artifact' 85 12 1 2DK3 GLY A 86 ? UNP Q9ULT8 ? ? 'cloning artifact' 86 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8mM U-15N,13C; 20mM phosphate buffer NA; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DK3 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DK3 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the lowest energy,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DK3 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.9321 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # _exptl.entry_id 2DK3 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DK3 _struct.title 'Solution structure of Mib-herc2 domain in HECT domain containing protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DK3 _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text ;Mib-herc2 domain, HECT domain containing protein 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id VAL _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 12 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 14 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id VAL _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 12 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 14 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 1 -0.03 2 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 2 -0.01 3 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 3 -0.07 4 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 4 -0.07 5 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 5 0.06 6 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 6 0.05 7 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 7 0.04 8 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 8 0.01 9 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 9 -0.08 10 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 10 -0.09 11 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 11 -0.04 12 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 12 -0.09 13 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 13 -0.03 14 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 14 -0.02 15 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 15 -0.11 16 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 16 0.01 17 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 17 0.03 18 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 18 -0.13 19 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 19 -0.05 20 SER 36 A . ? SER 36 A PRO 37 A ? PRO 37 A 20 -0.06 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 41 ? THR A 42 ? GLY A 41 THR A 42 A 2 ARG A 21 ? ARG A 24 ? ARG A 21 ARG A 24 A 3 LEU A 74 ? LEU A 76 ? LEU A 74 LEU A 76 B 1 TRP A 51 ? TRP A 56 ? TRP A 51 TRP A 56 B 2 GLY A 60 ? ARG A 65 ? GLY A 60 ARG A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLY A 41 ? O GLY A 41 N VAL A 22 ? N VAL A 22 A 2 3 N ILE A 23 ? N ILE A 23 O LYS A 75 ? O LYS A 75 B 1 2 N ILE A 52 ? N ILE A 52 O TYR A 64 ? O TYR A 64 # _database_PDB_matrix.entry_id 2DK3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DK3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 GLY 86 86 86 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-06 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 16 ? ? -64.40 78.85 2 1 ASP A 27 ? ? -90.90 30.32 3 1 ASP A 34 ? ? -87.68 39.35 4 1 GLN A 38 ? ? -34.46 139.55 5 1 LEU A 47 ? ? -57.40 103.81 6 1 PRO A 78 ? ? -69.72 83.62 7 2 SER A 10 ? ? -99.94 39.57 8 2 MET A 16 ? ? -64.76 74.53 9 2 PRO A 18 ? ? -69.78 99.08 10 2 ASP A 27 ? ? -85.08 34.56 11 2 LYS A 29 ? ? -87.04 36.02 12 2 ARG A 31 ? ? -102.27 -74.04 13 2 ASP A 34 ? ? -101.60 48.00 14 2 GLN A 38 ? ? -50.36 173.07 15 2 LEU A 47 ? ? -55.00 99.26 16 2 PRO A 78 ? ? -69.71 85.08 17 3 MET A 16 ? ? -63.66 78.02 18 3 LYS A 29 ? ? -84.91 41.83 19 3 ARG A 31 ? ? -82.85 -74.54 20 3 LEU A 47 ? ? -49.61 102.86 21 3 PRO A 78 ? ? -69.69 90.22 22 4 SER A 2 ? ? -44.61 157.60 23 4 ARG A 9 ? ? -55.24 -174.92 24 4 MET A 16 ? ? -59.63 82.83 25 4 PRO A 18 ? ? -69.80 99.50 26 4 ASP A 27 ? ? -88.51 30.81 27 4 ASP A 32 ? ? -64.51 82.79 28 4 GLN A 38 ? ? -33.84 111.75 29 4 LEU A 47 ? ? -45.84 108.01 30 4 PRO A 78 ? ? -69.76 82.87 31 4 SER A 81 ? ? -100.07 -61.91 32 5 SER A 5 ? ? -35.11 126.84 33 5 SER A 10 ? ? -92.69 53.44 34 5 PRO A 18 ? ? -69.74 96.82 35 5 ASP A 27 ? ? -87.38 45.30 36 5 ASP A 32 ? ? -51.45 94.14 37 5 ASP A 34 ? ? -92.23 38.61 38 5 THR A 42 ? ? -163.31 110.31 39 5 LEU A 47 ? ? -49.92 106.39 40 5 PRO A 78 ? ? -69.81 81.25 41 6 SER A 10 ? ? -95.60 44.49 42 6 MET A 16 ? ? -67.88 76.29 43 6 PRO A 18 ? ? -69.75 97.41 44 6 ASP A 27 ? ? -86.89 37.28 45 6 ARG A 31 ? ? -46.29 173.07 46 6 ASP A 32 ? ? -35.11 93.70 47 6 ASP A 34 ? ? -89.75 41.30 48 6 LEU A 47 ? ? -52.12 102.64 49 6 PRO A 78 ? ? -69.84 80.33 50 7 MET A 16 ? ? -67.09 72.73 51 7 PRO A 18 ? ? -69.81 96.25 52 7 ASP A 27 ? ? -98.44 34.23 53 7 THR A 42 ? ? -161.37 117.80 54 7 LEU A 47 ? ? -52.53 99.35 55 7 PRO A 78 ? ? -69.79 87.71 56 8 MET A 16 ? ? -66.60 75.43 57 8 PRO A 18 ? ? -69.76 95.84 58 8 ASP A 27 ? ? -91.52 35.65 59 8 ASP A 34 ? ? -89.74 43.90 60 8 LEU A 47 ? ? -45.47 99.80 61 8 PRO A 78 ? ? -69.83 84.52 62 9 SER A 10 ? ? -81.39 42.82 63 9 MET A 16 ? ? -55.73 82.15 64 9 PRO A 18 ? ? -69.75 98.09 65 9 ASP A 27 ? ? -82.80 38.35 66 9 LEU A 47 ? ? -54.94 100.54 67 9 PRO A 78 ? ? -69.79 82.49 68 9 SER A 81 ? ? 39.25 54.45 69 9 SER A 84 ? ? -173.19 127.78 70 10 SER A 3 ? ? -34.65 134.67 71 10 SER A 10 ? ? -86.12 41.22 72 10 PRO A 18 ? ? -69.82 95.43 73 10 ASP A 27 ? ? -83.26 37.41 74 10 LYS A 29 ? ? -90.79 36.70 75 10 ARG A 31 ? ? -61.29 -175.12 76 10 ASP A 34 ? ? -92.73 34.37 77 10 GLN A 38 ? ? -36.19 137.34 78 10 THR A 42 ? ? -161.81 117.21 79 10 LEU A 47 ? ? -47.78 103.72 80 10 PRO A 78 ? ? -69.77 81.49 81 10 SER A 81 ? ? -92.73 -68.59 82 10 PRO A 83 ? ? -69.82 2.82 83 11 MET A 16 ? ? -60.81 79.93 84 11 PRO A 18 ? ? -69.79 99.06 85 11 TRP A 28 ? ? -45.72 102.37 86 11 GLN A 38 ? ? -34.40 120.14 87 11 LEU A 47 ? ? -49.99 102.25 88 11 PRO A 78 ? ? -69.74 87.10 89 12 MET A 16 ? ? -62.59 92.52 90 12 PRO A 18 ? ? -69.72 95.29 91 12 ASP A 27 ? ? -83.03 39.70 92 12 LYS A 29 ? ? -87.02 33.56 93 12 ARG A 31 ? ? -102.11 -70.75 94 12 LEU A 47 ? ? -67.24 99.58 95 12 PRO A 78 ? ? -69.84 86.05 96 12 PRO A 83 ? ? -69.76 89.58 97 13 SER A 5 ? ? -167.00 112.51 98 13 SER A 10 ? ? -95.51 55.49 99 13 MET A 16 ? ? -65.89 75.06 100 13 PRO A 18 ? ? -69.81 96.07 101 13 ASP A 27 ? ? -85.62 35.64 102 13 ARG A 31 ? ? -85.06 -74.80 103 13 GLN A 38 ? ? -34.69 151.10 104 13 LEU A 47 ? ? -47.08 100.04 105 13 ASN A 49 ? ? 47.89 28.61 106 13 PRO A 78 ? ? -69.82 84.38 107 13 SER A 81 ? ? -102.37 -61.97 108 14 MET A 16 ? ? -62.18 76.45 109 14 PRO A 18 ? ? -69.69 91.57 110 14 ASP A 27 ? ? -92.04 39.49 111 14 TRP A 30 ? ? -49.80 178.30 112 14 ARG A 31 ? ? -114.13 -71.19 113 14 GLN A 38 ? ? -45.04 161.93 114 14 LEU A 47 ? ? -48.60 100.10 115 14 PRO A 78 ? ? -69.82 80.52 116 15 ARG A 9 ? ? -131.66 -48.45 117 15 SER A 10 ? ? -77.92 47.60 118 15 MET A 16 ? ? -66.37 77.91 119 15 PRO A 18 ? ? -69.71 94.61 120 15 ASP A 27 ? ? -87.26 46.05 121 15 LYS A 29 ? ? -82.63 40.76 122 15 ARG A 31 ? ? -90.99 -71.60 123 15 LEU A 47 ? ? -45.11 103.06 124 15 PRO A 78 ? ? -69.79 84.09 125 16 SER A 3 ? ? 38.17 39.18 126 16 SER A 10 ? ? -96.55 48.63 127 16 MET A 16 ? ? -59.85 85.48 128 16 PRO A 18 ? ? -69.73 93.52 129 16 ASP A 27 ? ? -87.10 46.90 130 16 LYS A 29 ? ? -80.09 42.43 131 16 ARG A 31 ? ? -105.19 -75.01 132 16 LEU A 47 ? ? -47.31 108.04 133 16 PRO A 78 ? ? -69.76 86.03 134 17 SER A 6 ? ? -67.44 99.43 135 17 SER A 10 ? ? -85.09 48.48 136 17 PRO A 18 ? ? -69.84 94.73 137 17 ASP A 27 ? ? -80.00 46.90 138 17 LYS A 29 ? ? -89.78 32.93 139 17 ARG A 31 ? ? -92.55 -75.07 140 17 GLN A 38 ? ? -36.68 146.77 141 17 LEU A 47 ? ? -49.58 103.98 142 17 PRO A 78 ? ? -69.75 93.28 143 17 SER A 81 ? ? -98.45 -60.25 144 17 PRO A 83 ? ? -69.76 2.80 145 18 SER A 10 ? ? -77.21 47.06 146 18 PRO A 18 ? ? -69.78 96.38 147 18 ASP A 27 ? ? -78.13 46.55 148 18 LYS A 29 ? ? -82.72 38.42 149 18 ARG A 31 ? ? -100.25 -71.26 150 18 ASP A 34 ? ? -99.93 47.48 151 18 GLN A 38 ? ? -57.76 173.95 152 18 LEU A 47 ? ? -51.61 101.95 153 18 PRO A 78 ? ? -69.73 86.03 154 18 PRO A 83 ? ? -69.73 1.45 155 19 SER A 6 ? ? -173.04 145.25 156 19 SER A 10 ? ? -81.92 42.95 157 19 MET A 16 ? ? -62.72 74.78 158 19 ASP A 27 ? ? -88.37 39.14 159 19 LYS A 29 ? ? -89.52 49.79 160 19 ASP A 32 ? ? -57.82 96.48 161 19 ASP A 34 ? ? -89.19 41.10 162 19 ASN A 49 ? ? 49.42 25.77 163 19 PRO A 78 ? ? -69.75 87.74 164 20 MET A 16 ? ? -55.22 82.93 165 20 PRO A 18 ? ? -69.71 96.63 166 20 ASP A 27 ? ? -87.55 33.74 167 20 ASP A 32 ? ? -62.63 80.17 168 20 ASP A 34 ? ? -90.88 44.55 169 20 GLN A 38 ? ? -35.81 149.21 170 20 LEU A 47 ? ? -46.56 105.83 171 20 PRO A 78 ? ? -69.80 87.15 172 20 SER A 85 ? ? 39.38 40.36 #