data_2DKM # _entry.id 2DKM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DKM pdb_00002dkm 10.2210/pdb2dkm/pdb RCSB RCSB025526 ? ? WWPDB D_1000025526 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002101482.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DKM _pdbx_database_status.recvd_initial_deposition_date 2006-04-12 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sato, M.' 1 'Saito, K.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structures of the fn3 domain of human collagen alpha-1(XX) chain' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sato, M.' 1 ? primary 'Saito, K.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Collagen alpha-1(XX) chain' _entity.formula_weight 10853.976 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Fibronectin type III domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGPLPPPRALTLAAVTPRTVHLTWQPSAGATHYLVRCSPASPKGEEEEREVQVGRPEVLLDGLEPGRDYEVSVQS LRGPEGSEARGIRARTPTSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGPLPPPRALTLAAVTPRTVHLTWQPSAGATHYLVRCSPASPKGEEEEREVQVGRPEVLLDGLEPGRDYEVSVQS LRGPEGSEARGIRARTPTSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002101482.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 LEU n 1 10 PRO n 1 11 PRO n 1 12 PRO n 1 13 ARG n 1 14 ALA n 1 15 LEU n 1 16 THR n 1 17 LEU n 1 18 ALA n 1 19 ALA n 1 20 VAL n 1 21 THR n 1 22 PRO n 1 23 ARG n 1 24 THR n 1 25 VAL n 1 26 HIS n 1 27 LEU n 1 28 THR n 1 29 TRP n 1 30 GLN n 1 31 PRO n 1 32 SER n 1 33 ALA n 1 34 GLY n 1 35 ALA n 1 36 THR n 1 37 HIS n 1 38 TYR n 1 39 LEU n 1 40 VAL n 1 41 ARG n 1 42 CYS n 1 43 SER n 1 44 PRO n 1 45 ALA n 1 46 SER n 1 47 PRO n 1 48 LYS n 1 49 GLY n 1 50 GLU n 1 51 GLU n 1 52 GLU n 1 53 GLU n 1 54 ARG n 1 55 GLU n 1 56 VAL n 1 57 GLN n 1 58 VAL n 1 59 GLY n 1 60 ARG n 1 61 PRO n 1 62 GLU n 1 63 VAL n 1 64 LEU n 1 65 LEU n 1 66 ASP n 1 67 GLY n 1 68 LEU n 1 69 GLU n 1 70 PRO n 1 71 GLY n 1 72 ARG n 1 73 ASP n 1 74 TYR n 1 75 GLU n 1 76 VAL n 1 77 SER n 1 78 VAL n 1 79 GLN n 1 80 SER n 1 81 LEU n 1 82 ARG n 1 83 GLY n 1 84 PRO n 1 85 GLU n 1 86 GLY n 1 87 SER n 1 88 GLU n 1 89 ALA n 1 90 ARG n 1 91 GLY n 1 92 ILE n 1 93 ARG n 1 94 ALA n 1 95 ARG n 1 96 THR n 1 97 PRO n 1 98 THR n 1 99 SER n 1 100 GLY n 1 101 PRO n 1 102 SER n 1 103 SER n 1 104 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene COL20A1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050711-10 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code COKA1_HUMAN _struct_ref.pdbx_db_accession Q9P218 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 473 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DKM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 98 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9P218 _struct_ref_seq.db_align_beg 473 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 563 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 98 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DKM GLY A 1 ? UNP Q9P218 ? ? 'cloning artifact' 1 1 1 2DKM SER A 2 ? UNP Q9P218 ? ? 'cloning artifact' 2 2 1 2DKM SER A 3 ? UNP Q9P218 ? ? 'cloning artifact' 3 3 1 2DKM GLY A 4 ? UNP Q9P218 ? ? 'cloning artifact' 4 4 1 2DKM SER A 5 ? UNP Q9P218 ? ? 'cloning artifact' 5 5 1 2DKM SER A 6 ? UNP Q9P218 ? ? 'cloning artifact' 6 6 1 2DKM GLY A 7 ? UNP Q9P218 ? ? 'cloning artifact' 7 7 1 2DKM SER A 99 ? UNP Q9P218 ? ? 'cloning artifact' 99 8 1 2DKM GLY A 100 ? UNP Q9P218 ? ? 'cloning artifact' 100 9 1 2DKM PRO A 101 ? UNP Q9P218 ? ? 'cloning artifact' 101 10 1 2DKM SER A 102 ? UNP Q9P218 ? ? 'cloning artifact' 102 11 1 2DKM SER A 103 ? UNP Q9P218 ? ? 'cloning artifact' 103 12 1 2DKM GLY A 104 ? UNP Q9P218 ? ? 'cloning artifact' 104 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM fn3 domain U-15N, 13C; 20mM d-Tris HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DKM _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DKM _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DKM _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DKM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DKM _struct.title 'Solution structures of the fn3 domain of human collagen alpha-1(XX) chain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DKM _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;fn3 domain, KIAA1510, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 16 ? VAL A 20 ? THR A 16 VAL A 20 A 2 THR A 24 ? THR A 28 ? THR A 24 THR A 28 A 3 GLU A 62 ? ASP A 66 ? GLU A 62 ASP A 66 B 1 ARG A 54 ? VAL A 58 ? ARG A 54 VAL A 58 B 2 HIS A 37 ? PRO A 44 ? HIS A 37 PRO A 44 B 3 TYR A 74 ? LEU A 81 ? TYR A 74 LEU A 81 B 4 ARG A 90 ? ARG A 93 ? ARG A 90 ARG A 93 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 16 ? N THR A 16 O THR A 28 ? O THR A 28 A 2 3 N VAL A 25 ? N VAL A 25 O LEU A 65 ? O LEU A 65 B 1 2 O VAL A 56 ? O VAL A 56 N VAL A 40 ? N VAL A 40 B 2 3 N SER A 43 ? N SER A 43 O GLU A 75 ? O GLU A 75 B 3 4 N VAL A 78 ? N VAL A 78 O ARG A 90 ? O ARG A 90 # _database_PDB_matrix.entry_id 2DKM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DKM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 GLY 104 104 104 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-12 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 52 ? ? -69.28 -175.36 2 1 PRO A 61 ? ? -69.74 2.97 3 1 ARG A 95 ? ? -175.05 140.73 4 1 PRO A 97 ? ? -69.79 -168.17 5 2 SER A 2 ? ? -56.26 98.76 6 2 PRO A 22 ? ? -69.82 2.03 7 2 GLU A 50 ? ? -103.27 45.00 8 2 GLU A 52 ? ? -39.28 156.90 9 2 PRO A 61 ? ? -69.81 3.45 10 2 PRO A 97 ? ? -69.80 -168.60 11 3 ALA A 14 ? ? -75.63 48.68 12 3 PRO A 47 ? ? -69.77 0.07 13 3 PRO A 61 ? ? -69.75 3.49 14 3 PRO A 97 ? ? -69.72 -165.19 15 3 SER A 99 ? ? -84.97 30.94 16 3 PRO A 101 ? ? -69.75 98.18 17 4 SER A 6 ? ? -95.40 35.78 18 4 ALA A 14 ? ? -76.07 47.91 19 4 GLU A 51 ? ? -50.36 100.63 20 4 GLU A 52 ? ? -170.07 138.42 21 4 PRO A 61 ? ? -69.80 3.35 22 4 PRO A 97 ? ? -69.75 -169.30 23 5 SER A 6 ? ? -165.40 112.51 24 5 PRO A 22 ? ? -69.74 2.44 25 5 PRO A 47 ? ? -69.74 0.86 26 5 GLU A 51 ? ? -67.20 86.27 27 5 PRO A 61 ? ? -69.74 3.53 28 5 ARG A 95 ? ? -175.03 143.82 29 5 PRO A 97 ? ? -69.74 -171.19 30 5 PRO A 101 ? ? -69.71 86.35 31 5 SER A 102 ? ? -57.67 174.73 32 6 SER A 3 ? ? -172.12 130.58 33 6 SER A 6 ? ? 36.37 46.07 34 6 PRO A 8 ? ? -69.72 -171.64 35 6 PRO A 22 ? ? -69.80 1.14 36 6 LYS A 48 ? ? -58.70 93.11 37 6 GLU A 50 ? ? -101.24 64.65 38 6 PRO A 61 ? ? -69.82 3.56 39 6 SER A 87 ? ? -69.04 -176.14 40 6 ARG A 93 ? ? -65.39 95.27 41 6 PRO A 97 ? ? -69.82 -165.11 42 7 PRO A 8 ? ? -69.75 97.19 43 7 PRO A 22 ? ? -69.79 1.28 44 7 ALA A 33 ? ? -117.58 56.90 45 7 PRO A 61 ? ? -69.77 3.47 46 7 ARG A 95 ? ? -174.78 143.52 47 7 PRO A 97 ? ? -69.75 -172.87 48 7 PRO A 101 ? ? -69.77 98.02 49 8 SER A 3 ? ? -35.04 95.63 50 8 PRO A 22 ? ? -69.71 2.19 51 8 GLU A 50 ? ? -123.52 -63.33 52 8 GLU A 51 ? ? -91.77 42.22 53 8 PRO A 61 ? ? -69.80 3.01 54 8 ARG A 93 ? ? -68.23 97.41 55 8 PRO A 97 ? ? -69.79 -172.39 56 8 SER A 99 ? ? -40.32 108.84 57 8 SER A 102 ? ? -35.42 127.23 58 9 SER A 2 ? ? -46.72 104.45 59 9 LYS A 48 ? ? -55.55 84.39 60 9 GLU A 51 ? ? 35.28 41.81 61 9 GLU A 52 ? ? -45.94 109.86 62 9 PRO A 61 ? ? -69.74 3.31 63 9 ARG A 93 ? ? -54.08 102.49 64 9 PRO A 97 ? ? -69.72 -173.27 65 10 SER A 3 ? ? -124.61 -53.92 66 10 PRO A 8 ? ? -69.70 97.01 67 10 ALA A 33 ? ? -102.82 54.74 68 10 PRO A 61 ? ? -69.73 3.38 69 10 ARG A 93 ? ? -55.48 103.38 70 10 PRO A 97 ? ? -69.84 -175.29 71 11 GLU A 51 ? ? -36.36 116.79 72 11 PRO A 61 ? ? -69.76 3.03 73 11 PRO A 97 ? ? -69.79 -174.45 74 11 PRO A 101 ? ? -69.82 2.82 75 11 SER A 102 ? ? -45.51 171.09 76 12 PRO A 22 ? ? -69.75 2.14 77 12 LYS A 48 ? ? -58.67 101.67 78 12 GLU A 50 ? ? -116.93 72.19 79 12 PRO A 61 ? ? -69.73 2.65 80 12 PRO A 97 ? ? -69.79 -171.20 81 12 SER A 99 ? ? -45.83 101.06 82 13 PRO A 8 ? ? -69.72 99.62 83 13 ALA A 14 ? ? -82.52 38.23 84 13 PRO A 22 ? ? -69.75 6.57 85 13 PRO A 61 ? ? -69.79 2.98 86 13 PRO A 97 ? ? -69.77 -170.91 87 14 SER A 2 ? ? -39.74 152.25 88 14 PRO A 22 ? ? -69.79 3.93 89 14 PRO A 47 ? ? -69.78 3.38 90 14 LYS A 48 ? ? -59.27 88.14 91 14 PRO A 61 ? ? -69.73 0.83 92 14 PRO A 97 ? ? -69.74 -171.93 93 15 PRO A 8 ? ? -69.75 86.25 94 15 PRO A 22 ? ? -69.77 1.94 95 15 PRO A 61 ? ? -69.75 4.19 96 15 PRO A 97 ? ? -69.76 -164.22 97 15 SER A 99 ? ? -34.47 115.74 98 16 SER A 6 ? ? -166.35 110.02 99 16 PRO A 8 ? ? -69.73 96.57 100 16 ALA A 35 ? ? -51.23 108.03 101 16 LYS A 48 ? ? -45.40 109.18 102 16 GLU A 51 ? ? -51.35 97.16 103 16 PRO A 61 ? ? -69.77 3.12 104 16 PRO A 97 ? ? -69.85 -171.07 105 17 PRO A 8 ? ? -69.81 99.33 106 17 PRO A 22 ? ? -69.72 7.97 107 17 GLU A 51 ? ? -43.85 152.67 108 17 PRO A 61 ? ? -69.83 2.08 109 17 ARG A 82 ? ? -134.99 -33.77 110 17 PRO A 97 ? ? -69.72 -171.10 111 18 PRO A 8 ? ? -69.75 -179.28 112 18 PRO A 61 ? ? -69.79 3.45 113 18 PRO A 97 ? ? -69.79 -171.98 114 18 SER A 99 ? ? -87.70 41.86 115 18 SER A 102 ? ? -171.98 142.36 116 19 SER A 3 ? ? -172.08 144.52 117 19 GLU A 50 ? ? -100.09 41.08 118 19 GLU A 52 ? ? -35.14 144.84 119 19 PRO A 61 ? ? -69.79 3.68 120 19 ARG A 82 ? ? -134.10 -47.68 121 19 PRO A 97 ? ? -69.81 -175.78 122 19 PRO A 101 ? ? -69.74 -179.67 123 20 PRO A 22 ? ? -69.73 1.92 124 20 GLU A 51 ? ? -102.69 40.10 125 20 PRO A 61 ? ? -69.68 3.35 126 20 PRO A 97 ? ? -69.77 -167.86 127 20 PRO A 101 ? ? -69.77 2.69 128 20 SER A 102 ? ? -36.33 113.95 129 20 SER A 103 ? ? -45.90 109.59 #