data_2DO1 # _entry.id 2DO1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.362 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DO1 pdb_00002do1 10.2210/pdb2do1/pdb RCSB RCSB025639 ? ? WWPDB D_1000025639 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001001035.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DO1 _pdbx_database_status.recvd_initial_deposition_date 2006-04-27 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Suzuki, S.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Terada, T.' 5 'Shirouzu, M.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the SAP domain of human nuclear protein Hcc-1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Suzuki, S.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Terada, T.' 5 ? primary 'Shirouzu, M.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Nuclear protein Hcc-1' _entity.formula_weight 5897.631 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SAP domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proliferation-associated cytokine-inducible protein CIP29' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGVELHKLKLAELKQECLARGLETKGIKQDLIHRLQAYLEEHAESGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGVELHKLKLAELKQECLARGLETKGIKQDLIHRLQAYLEEHAESGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001001035.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 VAL n 1 9 GLU n 1 10 LEU n 1 11 HIS n 1 12 LYS n 1 13 LEU n 1 14 LYS n 1 15 LEU n 1 16 ALA n 1 17 GLU n 1 18 LEU n 1 19 LYS n 1 20 GLN n 1 21 GLU n 1 22 CYS n 1 23 LEU n 1 24 ALA n 1 25 ARG n 1 26 GLY n 1 27 LEU n 1 28 GLU n 1 29 THR n 1 30 LYS n 1 31 GLY n 1 32 ILE n 1 33 LYS n 1 34 GLN n 1 35 ASP n 1 36 LEU n 1 37 ILE n 1 38 HIS n 1 39 ARG n 1 40 LEU n 1 41 GLN n 1 42 ALA n 1 43 TYR n 1 44 LEU n 1 45 GLU n 1 46 GLU n 1 47 HIS n 1 48 ALA n 1 49 GLU n 1 50 SER n 1 51 GLY n 1 52 PRO n 1 53 SER n 1 54 SER n 1 55 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'HCC1, HSPC316' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050829-15 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HCC1_HUMAN _struct_ref.pdbx_db_accession P82979 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 5 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DO1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 49 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P82979 _struct_ref_seq.db_align_beg 5 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 46 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 46 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DO1 GLY A 1 ? UNP P82979 ? ? 'cloning artifact' -2 1 1 2DO1 SER A 2 ? UNP P82979 ? ? 'cloning artifact' -1 2 1 2DO1 SER A 3 ? UNP P82979 ? ? 'cloning artifact' 0 3 1 2DO1 GLY A 4 ? UNP P82979 ? ? 'cloning artifact' 1 4 1 2DO1 SER A 5 ? UNP P82979 ? ? 'cloning artifact' 2 5 1 2DO1 SER A 6 ? UNP P82979 ? ? 'cloning artifact' 3 6 1 2DO1 GLY A 7 ? UNP P82979 ? ? 'cloning artifact' 4 7 1 2DO1 SER A 50 ? UNP P82979 ? ? 'cloning artifact' 47 8 1 2DO1 GLY A 51 ? UNP P82979 ? ? 'cloning artifact' 48 9 1 2DO1 PRO A 52 ? UNP P82979 ? ? 'cloning artifact' 49 10 1 2DO1 SER A 53 ? UNP P82979 ? ? 'cloning artifact' 50 11 1 2DO1 SER A 54 ? UNP P82979 ? ? 'cloning artifact' 51 12 1 2DO1 GLY A 55 ? UNP P82979 ? ? 'cloning artifact' 52 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.1mM 13C/15N-PROTEIN; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DO1 _pdbx_nmr_refine.method 'torsion angle dyanamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2DO1 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 2DO1 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DO1 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9321 'Kobayashi, N.' 4 'data analysis' Olivia 1.10.5 'Yokochi, M.' 5 'structure solution' CYANA 2.0.17 'Guntert, P.' 6 refinement CYANA 2.0.17 'Guntert, P.' 7 # _exptl.entry_id 2DO1 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DO1 _struct.title 'Solution structure of the SAP domain of human nuclear protein Hcc-1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DO1 _struct_keywords.pdbx_keywords 'GENE REGULATION' _struct_keywords.text ;SAP domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 14 ? GLY A 26 ? LYS A 11 GLY A 23 1 ? 13 HELX_P HELX_P2 2 ILE A 32 ? HIS A 47 ? ILE A 29 HIS A 44 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2DO1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DO1 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 -2 GLY GLY A . n A 1 2 SER 2 -1 -1 SER SER A . n A 1 3 SER 3 0 0 SER SER A . n A 1 4 GLY 4 1 1 GLY GLY A . n A 1 5 SER 5 2 2 SER SER A . n A 1 6 SER 6 3 3 SER SER A . n A 1 7 GLY 7 4 4 GLY GLY A . n A 1 8 VAL 8 5 5 VAL VAL A . n A 1 9 GLU 9 6 6 GLU GLU A . n A 1 10 LEU 10 7 7 LEU LEU A . n A 1 11 HIS 11 8 8 HIS HIS A . n A 1 12 LYS 12 9 9 LYS LYS A . n A 1 13 LEU 13 10 10 LEU LEU A . n A 1 14 LYS 14 11 11 LYS LYS A . n A 1 15 LEU 15 12 12 LEU LEU A . n A 1 16 ALA 16 13 13 ALA ALA A . n A 1 17 GLU 17 14 14 GLU GLU A . n A 1 18 LEU 18 15 15 LEU LEU A . n A 1 19 LYS 19 16 16 LYS LYS A . n A 1 20 GLN 20 17 17 GLN GLN A . n A 1 21 GLU 21 18 18 GLU GLU A . n A 1 22 CYS 22 19 19 CYS CYS A . n A 1 23 LEU 23 20 20 LEU LEU A . n A 1 24 ALA 24 21 21 ALA ALA A . n A 1 25 ARG 25 22 22 ARG ARG A . n A 1 26 GLY 26 23 23 GLY GLY A . n A 1 27 LEU 27 24 24 LEU LEU A . n A 1 28 GLU 28 25 25 GLU GLU A . n A 1 29 THR 29 26 26 THR THR A . n A 1 30 LYS 30 27 27 LYS LYS A . n A 1 31 GLY 31 28 28 GLY GLY A . n A 1 32 ILE 32 29 29 ILE ILE A . n A 1 33 LYS 33 30 30 LYS LYS A . n A 1 34 GLN 34 31 31 GLN GLN A . n A 1 35 ASP 35 32 32 ASP ASP A . n A 1 36 LEU 36 33 33 LEU LEU A . n A 1 37 ILE 37 34 34 ILE ILE A . n A 1 38 HIS 38 35 35 HIS HIS A . n A 1 39 ARG 39 36 36 ARG ARG A . n A 1 40 LEU 40 37 37 LEU LEU A . n A 1 41 GLN 41 38 38 GLN GLN A . n A 1 42 ALA 42 39 39 ALA ALA A . n A 1 43 TYR 43 40 40 TYR TYR A . n A 1 44 LEU 44 41 41 LEU LEU A . n A 1 45 GLU 45 42 42 GLU GLU A . n A 1 46 GLU 46 43 43 GLU GLU A . n A 1 47 HIS 47 44 44 HIS HIS A . n A 1 48 ALA 48 45 45 ALA ALA A . n A 1 49 GLU 49 46 46 GLU GLU A . n A 1 50 SER 50 47 47 SER SER A . n A 1 51 GLY 51 48 48 GLY GLY A . n A 1 52 PRO 52 49 49 PRO PRO A . n A 1 53 SER 53 50 50 SER SER A . n A 1 54 SER 54 51 51 SER SER A . n A 1 55 GLY 55 52 52 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-27 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2022-12-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 26 ? ? -85.57 39.72 2 1 HIS A 44 ? ? -92.26 39.37 3 1 SER A 50 ? ? -38.01 95.09 4 2 THR A 26 ? ? -93.10 36.17 5 3 THR A 26 ? ? -94.17 39.93 6 3 HIS A 44 ? ? -98.51 41.06 7 4 VAL A 5 ? ? -99.97 40.24 8 4 THR A 26 ? ? -84.07 31.47 9 5 THR A 26 ? ? -82.90 38.85 10 5 HIS A 44 ? ? -85.70 39.52 11 6 SER A -1 ? ? 35.18 42.15 12 6 HIS A 44 ? ? -90.99 40.36 13 6 PRO A 49 ? ? -69.77 -176.27 14 7 VAL A 5 ? ? -86.44 47.89 15 7 THR A 26 ? ? -97.65 38.20 16 7 PRO A 49 ? ? -69.76 2.60 17 8 HIS A 8 ? ? -88.66 43.98 18 8 HIS A 44 ? ? -103.35 41.73 19 9 SER A 3 ? ? -89.27 41.01 20 10 LYS A 9 ? ? -134.85 -44.58 21 10 THR A 26 ? ? -87.88 31.11 22 10 SER A 51 ? ? -84.27 43.01 23 11 VAL A 5 ? ? -109.85 42.00 24 11 THR A 26 ? ? -97.14 42.15 25 11 HIS A 44 ? ? -93.53 41.58 26 11 PRO A 49 ? ? -69.69 0.63 27 12 THR A 26 ? ? -84.40 41.36 28 12 HIS A 44 ? ? -106.64 44.21 29 12 SER A 47 ? ? 36.09 42.16 30 12 PRO A 49 ? ? -69.68 99.22 31 13 SER A 2 ? ? -174.30 117.55 32 13 LYS A 11 ? ? -59.02 176.23 33 13 THR A 26 ? ? -88.21 39.68 34 13 HIS A 44 ? ? -90.16 36.97 35 13 PRO A 49 ? ? -69.77 -178.61 36 14 THR A 26 ? ? -91.22 38.64 37 14 PRO A 49 ? ? -69.80 81.71 38 15 SER A 3 ? ? -42.37 155.58 39 15 HIS A 8 ? ? -34.78 -38.05 40 15 HIS A 44 ? ? -89.48 41.95 41 15 GLU A 46 ? ? -85.22 41.99 42 16 VAL A 5 ? ? -61.72 94.46 43 16 GLU A 6 ? ? -45.35 168.16 44 16 THR A 26 ? ? -82.30 39.99 45 16 HIS A 44 ? ? -85.59 35.67 46 16 ALA A 45 ? ? -37.32 124.42 47 16 PRO A 49 ? ? -69.82 95.04 48 17 SER A 0 ? ? -125.97 -57.08 49 17 THR A 26 ? ? -92.17 47.43 50 17 HIS A 44 ? ? -106.95 40.04 51 17 PRO A 49 ? ? -69.76 -176.80 52 17 SER A 51 ? ? -86.55 45.88 53 18 SER A -1 ? ? -37.89 108.25 54 18 SER A 2 ? ? -86.68 42.27 55 19 THR A 26 ? ? -104.31 48.89 56 19 HIS A 44 ? ? -104.24 41.79 57 20 THR A 26 ? ? -88.60 38.08 58 20 HIS A 44 ? ? -84.74 43.44 59 20 PRO A 49 ? ? -69.74 99.20 60 20 SER A 50 ? ? -88.12 42.31 #