data_2DS4 # _entry.id 2DS4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.362 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DS4 pdb_00002ds4 10.2210/pdb2ds4/pdb RCSB RCSB025777 ? ? WWPDB D_1000025777 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001001814.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DS4 _pdbx_database_status.recvd_initial_deposition_date 2006-06-21 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tomizawa, T.' 1 'Koshiba, S.' 2 'Watanabe, S.' 3 'Harada, T.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the filamin domain from human tripartite motif protein 45' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tomizawa, T.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Watanabe, S.' 3 ? primary 'Harada, T.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Tripartite motif protein 45' _entity.formula_weight 12386.970 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Filamin domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RING finger protein 99' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGEVDPAKCVLQGEDLHRAREKQTASFTLLCKDAAGEIMGRGGDNVQVAVVPKDKKDSPVRTMVQDNKDGTYYIS YTPKEPGVYTVWVCIKEQHVQGSPFTVTVRRKH ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGEVDPAKCVLQGEDLHRAREKQTASFTLLCKDAAGEIMGRGGDNVQVAVVPKDKKDSPVRTMVQDNKDGTYYIS YTPKEPGVYTVWVCIKEQHVQGSPFTVTVRRKH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001001814.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 VAL n 1 10 ASP n 1 11 PRO n 1 12 ALA n 1 13 LYS n 1 14 CYS n 1 15 VAL n 1 16 LEU n 1 17 GLN n 1 18 GLY n 1 19 GLU n 1 20 ASP n 1 21 LEU n 1 22 HIS n 1 23 ARG n 1 24 ALA n 1 25 ARG n 1 26 GLU n 1 27 LYS n 1 28 GLN n 1 29 THR n 1 30 ALA n 1 31 SER n 1 32 PHE n 1 33 THR n 1 34 LEU n 1 35 LEU n 1 36 CYS n 1 37 LYS n 1 38 ASP n 1 39 ALA n 1 40 ALA n 1 41 GLY n 1 42 GLU n 1 43 ILE n 1 44 MET n 1 45 GLY n 1 46 ARG n 1 47 GLY n 1 48 GLY n 1 49 ASP n 1 50 ASN n 1 51 VAL n 1 52 GLN n 1 53 VAL n 1 54 ALA n 1 55 VAL n 1 56 VAL n 1 57 PRO n 1 58 LYS n 1 59 ASP n 1 60 LYS n 1 61 LYS n 1 62 ASP n 1 63 SER n 1 64 PRO n 1 65 VAL n 1 66 ARG n 1 67 THR n 1 68 MET n 1 69 VAL n 1 70 GLN n 1 71 ASP n 1 72 ASN n 1 73 LYS n 1 74 ASP n 1 75 GLY n 1 76 THR n 1 77 TYR n 1 78 TYR n 1 79 ILE n 1 80 SER n 1 81 TYR n 1 82 THR n 1 83 PRO n 1 84 LYS n 1 85 GLU n 1 86 PRO n 1 87 GLY n 1 88 VAL n 1 89 TYR n 1 90 THR n 1 91 VAL n 1 92 TRP n 1 93 VAL n 1 94 CYS n 1 95 ILE n 1 96 LYS n 1 97 GLU n 1 98 GLN n 1 99 HIS n 1 100 VAL n 1 101 GLN n 1 102 GLY n 1 103 SER n 1 104 PRO n 1 105 PHE n 1 106 THR n 1 107 VAL n 1 108 THR n 1 109 VAL n 1 110 ARG n 1 111 ARG n 1 112 LYS n 1 113 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene TRIM45 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060227-22 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRI45_HUMAN _struct_ref.pdbx_db_accession Q9H8W5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EVDPAKCVLQGEDLHRAREKQTASFTLLCKDAAGEIMGRGGDNVQVAVVPKDKKDSPVRTMVQDNKDGTYYISYTPKEPG VYTVWVCIKEQHVQGSPFTVMVRRKH ; _struct_ref.pdbx_align_begin 396 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DS4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 113 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H8W5 _struct_ref_seq.db_align_beg 396 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 501 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 113 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DS4 GLY A 1 ? UNP Q9H8W5 ? ? 'cloning artifact' 1 1 1 2DS4 SER A 2 ? UNP Q9H8W5 ? ? 'cloning artifact' 2 2 1 2DS4 SER A 3 ? UNP Q9H8W5 ? ? 'cloning artifact' 3 3 1 2DS4 GLY A 4 ? UNP Q9H8W5 ? ? 'cloning artifact' 4 4 1 2DS4 SER A 5 ? UNP Q9H8W5 ? ? 'cloning artifact' 5 5 1 2DS4 SER A 6 ? UNP Q9H8W5 ? ? 'cloning artifact' 6 6 1 2DS4 GLY A 7 ? UNP Q9H8W5 ? ? 'cloning artifact' 7 7 1 2DS4 THR A 108 ? UNP Q9H8W5 MET 496 variant 108 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.15mM Filamin domain U-15N,13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O, 90% H2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2DS4 _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2DS4 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2DS4 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9742 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2DS4 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2DS4 _struct.title 'Solution structure of the filamin domain from human tripartite motif protein 45' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DS4 _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text ;beta-sandwich, immunoglobulin-like fold, filamin domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 1 -0.07 2 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 2 -0.04 3 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 3 -0.03 4 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 4 0.02 5 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 5 -0.05 6 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 6 -0.06 7 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 7 -0.03 8 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 8 -0.03 9 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 9 -0.05 10 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 10 -0.03 11 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 11 0.00 12 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 12 -0.07 13 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 13 -0.07 14 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 14 0.00 15 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 15 0.01 16 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 16 0.01 17 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 17 -0.08 18 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 18 0.00 19 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 19 -0.13 20 SER 103 A . ? SER 103 A PRO 104 A ? PRO 104 A 20 -0.08 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 15 ? GLN A 17 ? VAL A 15 GLN A 17 A 2 ALA A 30 ? LEU A 35 ? ALA A 30 LEU A 35 A 3 THR A 76 ? THR A 82 ? THR A 76 THR A 82 A 4 ARG A 66 ? GLN A 70 ? ARG A 66 GLN A 70 B 1 ARG A 23 ? ARG A 25 ? ARG A 23 ARG A 25 B 2 PHE A 105 ? ARG A 110 ? PHE A 105 ARG A 110 B 3 GLY A 87 ? ILE A 95 ? GLY A 87 ILE A 95 B 4 VAL A 51 ? PRO A 57 ? VAL A 51 PRO A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLN A 17 ? N GLN A 17 O THR A 33 ? O THR A 33 A 2 3 N ALA A 30 ? N ALA A 30 O TYR A 81 ? O TYR A 81 A 3 4 O TYR A 78 ? O TYR A 78 N GLN A 70 ? N GLN A 70 B 1 2 N ALA A 24 ? N ALA A 24 O ARG A 110 ? O ARG A 110 B 2 3 O VAL A 109 ? O VAL A 109 N GLY A 87 ? N GLY A 87 B 3 4 O TRP A 92 ? O TRP A 92 N ALA A 54 ? N ALA A 54 # _database_PDB_matrix.entry_id 2DS4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DS4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 CYS 94 94 94 CYS CYS A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 HIS 113 113 113 HIS HIS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-12-21 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2022-12-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? 36.07 47.24 2 1 ASP A 20 ? ? 39.67 53.03 3 1 PRO A 64 ? ? -69.76 -174.95 4 2 ASP A 20 ? ? -113.48 65.95 5 2 SER A 63 ? ? -33.25 96.45 6 2 PRO A 64 ? ? -69.79 -171.87 7 2 VAL A 100 ? ? -66.17 -178.64 8 2 LYS A 112 ? ? -46.03 152.26 9 3 ASP A 20 ? ? -107.95 69.47 10 3 ASN A 50 ? ? -58.19 98.13 11 3 SER A 63 ? ? -31.93 95.44 12 3 PRO A 64 ? ? -69.73 -178.53 13 3 VAL A 100 ? ? -51.92 176.61 14 3 PRO A 104 ? ? -69.74 -179.29 15 4 ASP A 20 ? ? -110.42 68.00 16 4 SER A 63 ? ? -35.29 97.94 17 5 ASP A 20 ? ? -112.73 69.54 18 5 GLU A 26 ? ? -39.74 143.27 19 5 LYS A 27 ? ? 34.08 49.50 20 5 SER A 63 ? ? -34.60 97.48 21 5 VAL A 100 ? ? -66.22 -178.82 22 6 ASP A 20 ? ? -101.48 71.78 23 6 ASP A 62 ? ? -99.80 -63.83 24 6 SER A 63 ? ? -34.68 97.42 25 6 LYS A 112 ? ? -40.29 159.75 26 7 SER A 63 ? ? -32.49 95.78 27 7 ARG A 110 ? ? -61.80 -178.29 28 8 ASP A 20 ? ? -90.09 43.21 29 8 ALA A 54 ? ? -171.32 110.39 30 8 SER A 63 ? ? -32.29 95.72 31 8 PRO A 64 ? ? -69.78 -179.91 32 8 ARG A 66 ? ? -67.59 99.79 33 9 ASP A 20 ? ? -92.16 49.67 34 9 ASP A 62 ? ? -107.52 -64.53 35 9 SER A 63 ? ? -34.22 97.06 36 9 PRO A 64 ? ? -69.73 -175.10 37 10 LYS A 27 ? ? 37.05 49.67 38 10 SER A 63 ? ? -31.48 95.06 39 11 SER A 3 ? ? -162.72 113.02 40 11 ASP A 20 ? ? -111.32 73.06 41 11 LYS A 27 ? ? 33.33 54.89 42 11 SER A 63 ? ? -32.16 95.55 43 11 PRO A 64 ? ? -69.72 -172.57 44 12 CYS A 14 ? ? -46.14 160.74 45 12 ASN A 50 ? ? -66.71 98.03 46 12 PRO A 64 ? ? -69.78 -178.81 47 12 VAL A 100 ? ? -50.00 -179.75 48 13 CYS A 14 ? ? -47.14 156.56 49 13 ASP A 62 ? ? -94.67 -60.23 50 13 SER A 63 ? ? -37.12 99.16 51 14 ASP A 20 ? ? -106.15 69.71 52 14 SER A 63 ? ? -31.91 95.44 53 14 PRO A 64 ? ? -69.76 -178.80 54 15 LYS A 27 ? ? 38.87 52.13 55 15 SER A 63 ? ? -33.43 96.62 56 15 PRO A 64 ? ? -69.79 -179.28 57 15 ARG A 66 ? ? -54.51 106.25 58 15 LYS A 73 ? ? 47.59 28.36 59 16 ASP A 20 ? ? -108.39 59.33 60 16 ASP A 62 ? ? -96.67 -64.25 61 16 SER A 63 ? ? -33.34 96.55 62 16 ASP A 74 ? ? -133.36 -34.96 63 16 VAL A 100 ? ? -54.68 -177.36 64 16 ARG A 111 ? ? -50.71 170.43 65 16 LYS A 112 ? ? -46.96 174.84 66 17 ASP A 20 ? ? -119.00 61.33 67 17 SER A 63 ? ? -31.96 95.43 68 17 PRO A 64 ? ? -69.80 -176.17 69 17 PRO A 104 ? ? -69.75 -179.47 70 17 LYS A 112 ? ? -42.11 159.85 71 18 SER A 5 ? ? 38.25 48.04 72 18 LYS A 27 ? ? 34.33 44.40 73 18 ASP A 62 ? ? -92.41 -64.34 74 18 SER A 63 ? ? -32.57 95.93 75 18 PRO A 64 ? ? -69.76 -178.05 76 18 LYS A 73 ? ? 33.16 38.95 77 18 PRO A 83 ? ? -69.78 94.71 78 18 VAL A 100 ? ? -54.54 -175.24 79 18 ARG A 110 ? ? -59.68 -175.51 80 19 SER A 63 ? ? -32.61 95.95 81 19 PRO A 64 ? ? -69.71 -175.87 82 20 SER A 3 ? ? -49.91 172.38 83 20 CYS A 14 ? ? -40.86 158.96 84 20 ASP A 20 ? ? -111.10 74.47 85 20 ASP A 59 ? ? -65.10 -71.13 86 20 SER A 63 ? ? -38.83 100.38 87 20 LYS A 73 ? ? 31.41 44.56 #