data_2E6I # _entry.id 2E6I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2E6I pdb_00002e6i 10.2210/pdb2e6i/pdb RCSB RCSB026286 ? ? WWPDB D_1000026286 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso002001763.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2E6I _pdbx_database_status.recvd_initial_deposition_date 2006-12-27 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, H.' 1 'Tochio, N.' 2 'Koshiba, S.' 3 'Watanabe, S.' 4 'Harada, T.' 5 'Kigawa, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the BTK motif of tyrosine-protein kinase ITK from human' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, H.' 1 ? primary 'Tochio, N.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Watanabe, S.' 4 ? primary 'Harada, T.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Yokoyama, S.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine-protein kinase ITK/TSK' 7159.044 1 2.7.10.2 ? 'BTK motif' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'T-cell-specific kinase, Tyrosine-protein kinase Lyk, Kinase EMT' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGNNSLVPKYHPNFWMDGKWRCCSQLEKLATGCAQYDPTKNASKKPLPPTPEDNRRPLW _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGNNSLVPKYHPNFWMDGKWRCCSQLEKLATGCAQYDPTKNASKKPLPPTPEDNRRPLW _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso002001763.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ASN n 1 9 ASN n 1 10 SER n 1 11 LEU n 1 12 VAL n 1 13 PRO n 1 14 LYS n 1 15 TYR n 1 16 HIS n 1 17 PRO n 1 18 ASN n 1 19 PHE n 1 20 TRP n 1 21 MET n 1 22 ASP n 1 23 GLY n 1 24 LYS n 1 25 TRP n 1 26 ARG n 1 27 CYS n 1 28 CYS n 1 29 SER n 1 30 GLN n 1 31 LEU n 1 32 GLU n 1 33 LYS n 1 34 LEU n 1 35 ALA n 1 36 THR n 1 37 GLY n 1 38 CYS n 1 39 ALA n 1 40 GLN n 1 41 TYR n 1 42 ASP n 1 43 PRO n 1 44 THR n 1 45 LYS n 1 46 ASN n 1 47 ALA n 1 48 SER n 1 49 LYS n 1 50 LYS n 1 51 PRO n 1 52 LEU n 1 53 PRO n 1 54 PRO n 1 55 THR n 1 56 PRO n 1 57 GLU n 1 58 ASP n 1 59 ASN n 1 60 ARG n 1 61 ARG n 1 62 PRO n 1 63 LEU n 1 64 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ITK _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060123-02 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ITK_HUMAN _struct_ref.pdbx_db_accession Q08881 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NNSLVPKYHPNFWMDGKWRCCSQLEKLATGCAQYDPTKNASKKPLPPTPEDNRRPLW _struct_ref.pdbx_align_begin 113 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2E6I _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q08881 _struct_ref_seq.db_align_beg 113 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 169 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 64 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2E6I GLY A 1 ? UNP Q08881 ? ? 'cloning artifact' 1 1 1 2E6I SER A 2 ? UNP Q08881 ? ? 'cloning artifact' 2 2 1 2E6I SER A 3 ? UNP Q08881 ? ? 'cloning artifact' 3 3 1 2E6I GLY A 4 ? UNP Q08881 ? ? 'cloning artifact' 4 4 1 2E6I SER A 5 ? UNP Q08881 ? ? 'cloning artifact' 5 5 1 2E6I SER A 6 ? UNP Q08881 ? ? 'cloning artifact' 6 6 1 2E6I GLY A 7 ? UNP Q08881 ? ? 'cloning artifact' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.12mM BTK motif U-15N, 13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2E6I _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2E6I _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2E6I _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.932 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2E6I _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2E6I _struct.title 'Solution structure of the BTK motif of tyrosine-protein kinase ITK from human' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2E6I _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;BTK, Tyrosine-protein kinase ITK/TSK, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 16 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 16 A ZN 201 1_555 ? ? ? ? ? ? ? 2.097 ? ? metalc2 metalc ? ? A CYS 27 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 27 A ZN 201 1_555 ? ? ? ? ? ? ? 2.192 ? ? metalc3 metalc ? ? A CYS 28 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 201 1_555 ? ? ? ? ? ? ? 2.288 ? ? metalc4 metalc ? ? A CYS 38 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 38 A ZN 201 1_555 ? ? ? ? ? ? ? 2.289 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 14 ? TYR A 15 ? LYS A 14 TYR A 15 A 2 ALA A 39 ? GLN A 40 ? ALA A 39 GLN A 40 B 1 TRP A 20 ? MET A 21 ? TRP A 20 MET A 21 B 2 LYS A 24 ? TRP A 25 ? LYS A 24 TRP A 25 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 15 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 15 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ALA _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 39 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 39 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 16 ? HIS A 16 . ? 1_555 ? 2 AC1 4 CYS A 27 ? CYS A 27 . ? 1_555 ? 3 AC1 4 CYS A 28 ? CYS A 28 . ? 1_555 ? 4 AC1 4 CYS A 38 ? CYS A 38 . ? 1_555 ? # _database_PDB_matrix.entry_id 2E6I _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2E6I _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 TRP 64 64 64 TRP TRP A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 16 ? A HIS 16 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 27 ? A CYS 27 ? 1_555 115.7 ? 2 ND1 ? A HIS 16 ? A HIS 16 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 28 ? A CYS 28 ? 1_555 100.3 ? 3 SG ? A CYS 27 ? A CYS 27 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 28 ? A CYS 28 ? 1_555 117.2 ? 4 ND1 ? A HIS 16 ? A HIS 16 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 116.0 ? 5 SG ? A CYS 27 ? A CYS 27 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 105.2 ? 6 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 102.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-07-03 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_ref_seq_dif.details' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_remark.id 700 _pdbx_database_remark.text ;SHEET Determination method: Author determined ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 12 ? ? -35.81 136.37 2 1 PRO A 13 ? ? -69.74 98.71 3 1 PRO A 17 ? ? -69.76 3.19 4 1 ASP A 22 ? ? 71.31 45.89 5 1 LYS A 24 ? ? -174.76 145.86 6 1 TYR A 41 ? ? -48.10 175.88 7 1 LYS A 45 ? ? -60.33 91.15 8 1 PRO A 54 ? ? -69.72 -173.43 9 1 ASN A 59 ? ? -36.27 146.08 10 1 ARG A 60 ? ? -48.20 176.51 11 1 ARG A 61 ? ? -170.38 148.39 12 1 LEU A 63 ? ? -111.58 58.78 13 2 PRO A 13 ? ? -69.78 93.90 14 2 PRO A 17 ? ? -69.71 1.57 15 2 ASP A 22 ? ? -75.73 48.48 16 2 LYS A 24 ? ? -172.58 -179.58 17 2 TYR A 41 ? ? -50.67 177.27 18 2 ASN A 46 ? ? -125.72 -59.46 19 2 ALA A 47 ? ? -34.83 144.92 20 2 PRO A 56 ? ? -69.73 2.78 21 2 GLU A 57 ? ? -47.90 175.17 22 2 ASP A 58 ? ? -34.61 136.69 23 2 ASN A 59 ? ? -58.83 179.76 24 2 PRO A 62 ? ? -69.80 -179.36 25 2 LEU A 63 ? ? -80.58 43.40 26 3 PRO A 17 ? ? -69.75 2.58 27 3 ASP A 22 ? ? -34.81 -39.91 28 3 LEU A 31 ? ? -81.73 41.58 29 3 LEU A 34 ? ? -98.23 39.25 30 3 TYR A 41 ? ? -45.65 165.31 31 3 LYS A 49 ? ? -120.88 -51.72 32 3 LYS A 50 ? ? -172.63 139.57 33 3 PRO A 56 ? ? -69.74 3.00 34 3 GLU A 57 ? ? 34.80 41.65 35 4 SER A 3 ? ? -46.84 166.09 36 4 ASN A 9 ? ? -96.73 -61.54 37 4 ASP A 22 ? ? -34.72 -34.90 38 4 ALA A 35 ? ? -37.85 129.87 39 4 TYR A 41 ? ? -47.85 161.79 40 4 LYS A 45 ? ? -130.61 -33.54 41 4 ASN A 46 ? ? -83.22 44.98 42 4 ALA A 47 ? ? 34.91 42.97 43 4 SER A 48 ? ? -173.45 146.38 44 4 PRO A 56 ? ? -69.77 -177.09 45 4 GLU A 57 ? ? -37.12 122.87 46 4 ASN A 59 ? ? -35.22 145.61 47 4 ARG A 60 ? ? 73.01 40.31 48 4 ARG A 61 ? ? -45.42 152.48 49 4 LEU A 63 ? ? -89.34 37.25 50 5 PRO A 13 ? ? -69.74 95.54 51 5 PRO A 17 ? ? -69.68 1.58 52 5 ALA A 35 ? ? -42.58 157.27 53 5 TYR A 41 ? ? -52.04 -177.24 54 5 PRO A 43 ? ? -69.74 2.77 55 5 THR A 44 ? ? -174.93 129.03 56 5 PRO A 51 ? ? -69.77 -179.77 57 5 PRO A 56 ? ? -69.75 -178.47 58 5 GLU A 57 ? ? -34.55 108.39 59 6 LEU A 11 ? ? -51.79 178.07 60 6 PRO A 13 ? ? -69.78 95.66 61 6 PRO A 17 ? ? -69.75 3.08 62 6 ASP A 22 ? ? 31.76 49.41 63 6 TYR A 41 ? ? -49.65 -179.33 64 6 ASN A 46 ? ? 37.42 43.37 65 6 PRO A 56 ? ? -69.76 -176.67 66 6 GLU A 57 ? ? -34.34 118.77 67 6 ARG A 60 ? ? -34.55 139.06 68 6 PRO A 62 ? ? -69.77 -178.70 69 7 LEU A 11 ? ? -47.82 176.55 70 7 ASP A 22 ? ? -34.42 -33.17 71 7 LYS A 24 ? ? -175.03 -176.97 72 7 ALA A 35 ? ? -37.76 145.82 73 7 TYR A 41 ? ? -43.21 153.03 74 7 PRO A 56 ? ? -69.80 2.92 75 8 ASN A 8 ? ? -108.58 42.72 76 8 PRO A 13 ? ? -69.76 96.86 77 8 PRO A 17 ? ? -69.72 3.17 78 8 LEU A 31 ? ? -91.11 39.90 79 8 ALA A 35 ? ? -35.03 134.67 80 8 TYR A 41 ? ? -48.59 162.76 81 8 PRO A 51 ? ? -69.78 -175.48 82 8 PRO A 54 ? ? -69.76 -175.32 83 8 PRO A 56 ? ? -69.72 -176.35 84 9 SER A 6 ? ? -106.22 42.18 85 9 LEU A 31 ? ? -93.21 39.94 86 9 LEU A 34 ? ? -99.91 35.66 87 9 TYR A 41 ? ? -43.69 152.61 88 9 SER A 48 ? ? -173.22 130.23 89 9 PRO A 54 ? ? -69.72 -171.29 90 9 THR A 55 ? ? -34.27 142.66 91 10 PRO A 17 ? ? -69.72 3.07 92 10 LEU A 34 ? ? -107.02 42.18 93 10 TYR A 41 ? ? -47.55 159.37 94 10 LYS A 45 ? ? -107.04 44.07 95 10 SER A 48 ? ? -56.05 97.18 96 10 PRO A 51 ? ? -69.78 -178.16 97 10 PRO A 56 ? ? -69.80 86.23 98 10 ASP A 58 ? ? -40.43 101.54 99 11 SER A 2 ? ? -163.79 115.06 100 11 SER A 6 ? ? -42.55 159.21 101 11 ASP A 22 ? ? -34.37 -33.48 102 11 LEU A 34 ? ? -96.94 34.84 103 11 ASN A 59 ? ? -170.08 112.47 104 12 LEU A 11 ? ? -36.76 107.57 105 12 VAL A 12 ? ? -35.93 137.09 106 12 PRO A 17 ? ? -69.79 2.88 107 12 LYS A 24 ? ? -171.12 -174.96 108 12 SER A 29 ? ? 73.92 45.94 109 12 LEU A 34 ? ? -101.20 41.61 110 12 TYR A 41 ? ? -50.66 174.65 111 12 LYS A 45 ? ? -41.12 106.01 112 12 ALA A 47 ? ? -172.39 138.35 113 12 LYS A 50 ? ? -46.03 154.25 114 12 PRO A 51 ? ? -69.82 -179.75 115 12 PRO A 56 ? ? -69.73 2.84 116 12 ARG A 60 ? ? -36.14 124.98 117 12 PRO A 62 ? ? -69.75 -172.66 118 13 PRO A 17 ? ? -69.76 3.05 119 13 ASP A 22 ? ? -40.02 91.32 120 13 LEU A 31 ? ? -89.09 45.91 121 13 ALA A 35 ? ? -44.30 153.10 122 13 TYR A 41 ? ? -46.43 159.48 123 13 SER A 48 ? ? -42.84 108.75 124 13 PRO A 54 ? ? -69.85 -178.46 125 13 GLU A 57 ? ? -52.73 -176.12 126 14 ASN A 9 ? ? -60.88 97.23 127 14 PRO A 17 ? ? -69.74 3.39 128 14 TYR A 41 ? ? -44.08 155.77 129 14 ASN A 46 ? ? -60.99 -70.08 130 14 PRO A 56 ? ? -69.76 -166.31 131 14 ARG A 60 ? ? -57.49 -179.03 132 14 PRO A 62 ? ? -69.78 -179.74 133 14 LEU A 63 ? ? -105.36 -60.07 134 15 SER A 3 ? ? -126.95 -55.09 135 15 ASN A 8 ? ? -81.91 45.26 136 15 LYS A 24 ? ? -174.49 146.83 137 15 LEU A 34 ? ? -100.51 43.94 138 15 ALA A 35 ? ? -39.60 116.70 139 15 TYR A 41 ? ? -48.11 175.15 140 15 LYS A 45 ? ? -55.41 94.43 141 15 LYS A 49 ? ? -170.61 107.22 142 15 PRO A 51 ? ? -69.73 -177.89 143 15 GLU A 57 ? ? -49.32 155.69 144 15 ARG A 61 ? ? -36.82 155.83 145 16 SER A 6 ? ? -169.33 119.92 146 16 PRO A 17 ? ? -69.79 3.07 147 16 ASP A 22 ? ? 37.95 47.55 148 16 GLN A 30 ? ? -66.36 -178.46 149 16 ALA A 35 ? ? -37.06 129.27 150 16 LEU A 52 ? ? -34.82 144.01 151 16 PRO A 54 ? ? -69.78 -173.38 152 16 PRO A 56 ? ? -69.73 -171.38 153 16 LEU A 63 ? ? -101.89 55.54 154 17 SER A 3 ? ? -107.71 -62.07 155 17 SER A 6 ? ? -41.27 157.77 156 17 GLU A 32 ? ? -59.51 174.22 157 17 PRO A 54 ? ? -69.79 -172.32 158 17 THR A 55 ? ? -39.43 153.07 159 17 PRO A 62 ? ? -69.73 -173.19 160 18 SER A 3 ? ? -122.22 -62.04 161 18 SER A 5 ? ? -174.79 118.67 162 18 VAL A 12 ? ? -39.28 130.97 163 18 PRO A 17 ? ? -69.79 1.80 164 18 ASP A 22 ? ? -44.19 88.91 165 18 GLU A 32 ? ? -38.91 118.30 166 18 LEU A 34 ? ? -100.57 45.92 167 18 ALA A 35 ? ? -49.15 152.91 168 18 TYR A 41 ? ? -47.52 172.68 169 18 ALA A 47 ? ? -123.88 -61.13 170 18 PRO A 56 ? ? -69.71 2.79 171 19 PRO A 13 ? ? -69.78 96.90 172 19 PRO A 17 ? ? -69.78 3.24 173 19 ASP A 22 ? ? -36.28 -31.84 174 19 GLN A 30 ? ? -61.89 -177.67 175 19 ALA A 35 ? ? -39.63 146.48 176 19 LYS A 45 ? ? 37.27 47.97 177 19 ASN A 46 ? ? -171.89 148.02 178 19 PRO A 51 ? ? -69.79 -179.29 179 19 ASN A 59 ? ? -65.19 81.79 180 19 PRO A 62 ? ? -69.72 -171.34 181 19 LEU A 63 ? ? -131.51 -52.48 182 20 ASN A 8 ? ? -90.13 51.90 183 20 MET A 21 ? ? -127.59 -70.64 184 20 ASP A 22 ? ? -68.34 70.26 185 20 SER A 29 ? ? 73.41 34.02 186 20 LEU A 34 ? ? -102.21 40.08 187 20 TYR A 41 ? ? -66.67 -175.96 188 20 ASN A 46 ? ? -91.98 55.63 189 20 ALA A 47 ? ? -173.96 136.88 190 20 LYS A 50 ? ? -41.39 159.54 191 20 PRO A 56 ? ? -69.76 99.27 192 20 ASP A 58 ? ? 38.28 51.81 193 20 ASN A 59 ? ? -98.37 39.13 194 20 LEU A 63 ? ? -101.38 52.08 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #