data_2E6Z # _entry.id 2E6Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2E6Z pdb_00002e6z 10.2210/pdb2e6z/pdb RCSB RCSB026303 ? ? WWPDB D_1000026303 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk003001095.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2E6Z _pdbx_database_status.recvd_initial_deposition_date 2007-01-05 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tanabe, W.' 1 'Suzuki, S.' 2 'Muto, Y.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Terada, T.' 6 'Shirouzu, M.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of the second KOW motif of human transcription elongation factor SPT5' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tanabe, W.' 1 ? primary 'Suzuki, S.' 2 ? primary 'Muto, Y.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Terada, T.' 6 ? primary 'Shirouzu, M.' 7 ? primary 'Yokoyama, S.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Transcription elongation factor SPT5' _entity.formula_weight 6471.286 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'KOW motif' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;hSPT5, DRB sensitivity-inducing factor large subunit, DSIF large subunit, DSIF p160, Tat-cotransactivator 1 protein, Tat-CT1 protein ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGFQPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKY _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGFQPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKY _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk003001095.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PHE n 1 9 GLN n 1 10 PRO n 1 11 GLY n 1 12 ASP n 1 13 ASN n 1 14 VAL n 1 15 GLU n 1 16 VAL n 1 17 CYS n 1 18 GLU n 1 19 GLY n 1 20 GLU n 1 21 LEU n 1 22 ILE n 1 23 ASN n 1 24 LEU n 1 25 GLN n 1 26 GLY n 1 27 LYS n 1 28 ILE n 1 29 LEU n 1 30 SER n 1 31 VAL n 1 32 ASP n 1 33 GLY n 1 34 ASN n 1 35 LYS n 1 36 ILE n 1 37 THR n 1 38 ILE n 1 39 MET n 1 40 PRO n 1 41 LYS n 1 42 HIS n 1 43 GLU n 1 44 ASP n 1 45 LEU n 1 46 LYS n 1 47 ASP n 1 48 MET n 1 49 LEU n 1 50 GLU n 1 51 PHE n 1 52 PRO n 1 53 ALA n 1 54 GLN n 1 55 GLU n 1 56 LEU n 1 57 ARG n 1 58 LYS n 1 59 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'SUPT5H, SPT5, SPT5H' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060123-32 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SPT5H_HUMAN _struct_ref.pdbx_db_accession O00267 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code FQPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKY _struct_ref.pdbx_align_begin 420 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2E6Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 59 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O00267 _struct_ref_seq.db_align_beg 420 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 471 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 420 _struct_ref_seq.pdbx_auth_seq_align_end 471 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2E6Z GLY A 1 ? UNP O00267 ? ? 'cloning artifact' 413 1 1 2E6Z SER A 2 ? UNP O00267 ? ? 'cloning artifact' 414 2 1 2E6Z SER A 3 ? UNP O00267 ? ? 'cloning artifact' 415 3 1 2E6Z GLY A 4 ? UNP O00267 ? ? 'cloning artifact' 416 4 1 2E6Z SER A 5 ? UNP O00267 ? ? 'cloning artifact' 417 5 1 2E6Z SER A 6 ? UNP O00267 ? ? 'cloning artifact' 418 6 1 2E6Z GLY A 7 ? UNP O00267 ? ? 'cloning artifact' 419 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 280 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.11mM 13C-15N PROTEIN; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2E6Z _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2E6Z _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2E6Z _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9742 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2E6Z _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2E6Z _struct.title 'Solution structure of the second KOW motif of human transcription elongation factor SPT5' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2E6Z _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;KOW motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 49 ? PRO A 52 ? LEU A 461 PRO A 464 A 2 LYS A 35 ? PRO A 40 ? LYS A 447 PRO A 452 A 3 LEU A 24 ? ASP A 32 ? LEU A 436 ASP A 444 A 4 ASN A 13 ? VAL A 16 ? ASN A 425 VAL A 428 A 5 LEU A 56 ? LYS A 58 ? LEU A 468 LYS A 470 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 51 ? O PHE A 463 N ILE A 36 ? N ILE A 448 A 2 3 O MET A 39 ? O MET A 451 N LYS A 27 ? N LYS A 439 A 3 4 O GLY A 26 ? O GLY A 438 N VAL A 14 ? N VAL A 426 A 4 5 N GLU A 15 ? N GLU A 427 O ARG A 57 ? O ARG A 469 # _database_PDB_matrix.entry_id 2E6Z _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2E6Z _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 413 413 GLY GLY A . n A 1 2 SER 2 414 414 SER SER A . n A 1 3 SER 3 415 415 SER SER A . n A 1 4 GLY 4 416 416 GLY GLY A . n A 1 5 SER 5 417 417 SER SER A . n A 1 6 SER 6 418 418 SER SER A . n A 1 7 GLY 7 419 419 GLY GLY A . n A 1 8 PHE 8 420 420 PHE PHE A . n A 1 9 GLN 9 421 421 GLN GLN A . n A 1 10 PRO 10 422 422 PRO PRO A . n A 1 11 GLY 11 423 423 GLY GLY A . n A 1 12 ASP 12 424 424 ASP ASP A . n A 1 13 ASN 13 425 425 ASN ASN A . n A 1 14 VAL 14 426 426 VAL VAL A . n A 1 15 GLU 15 427 427 GLU GLU A . n A 1 16 VAL 16 428 428 VAL VAL A . n A 1 17 CYS 17 429 429 CYS CYS A . n A 1 18 GLU 18 430 430 GLU GLU A . n A 1 19 GLY 19 431 431 GLY GLY A . n A 1 20 GLU 20 432 432 GLU GLU A . n A 1 21 LEU 21 433 433 LEU LEU A . n A 1 22 ILE 22 434 434 ILE ILE A . n A 1 23 ASN 23 435 435 ASN ASN A . n A 1 24 LEU 24 436 436 LEU LEU A . n A 1 25 GLN 25 437 437 GLN GLN A . n A 1 26 GLY 26 438 438 GLY GLY A . n A 1 27 LYS 27 439 439 LYS LYS A . n A 1 28 ILE 28 440 440 ILE ILE A . n A 1 29 LEU 29 441 441 LEU LEU A . n A 1 30 SER 30 442 442 SER SER A . n A 1 31 VAL 31 443 443 VAL VAL A . n A 1 32 ASP 32 444 444 ASP ASP A . n A 1 33 GLY 33 445 445 GLY GLY A . n A 1 34 ASN 34 446 446 ASN ASN A . n A 1 35 LYS 35 447 447 LYS LYS A . n A 1 36 ILE 36 448 448 ILE ILE A . n A 1 37 THR 37 449 449 THR THR A . n A 1 38 ILE 38 450 450 ILE ILE A . n A 1 39 MET 39 451 451 MET MET A . n A 1 40 PRO 40 452 452 PRO PRO A . n A 1 41 LYS 41 453 453 LYS LYS A . n A 1 42 HIS 42 454 454 HIS HIS A . n A 1 43 GLU 43 455 455 GLU GLU A . n A 1 44 ASP 44 456 456 ASP ASP A . n A 1 45 LEU 45 457 457 LEU LEU A . n A 1 46 LYS 46 458 458 LYS LYS A . n A 1 47 ASP 47 459 459 ASP ASP A . n A 1 48 MET 48 460 460 MET MET A . n A 1 49 LEU 49 461 461 LEU LEU A . n A 1 50 GLU 50 462 462 GLU GLU A . n A 1 51 PHE 51 463 463 PHE PHE A . n A 1 52 PRO 52 464 464 PRO PRO A . n A 1 53 ALA 53 465 465 ALA ALA A . n A 1 54 GLN 54 466 466 GLN GLN A . n A 1 55 GLU 55 467 467 GLU GLU A . n A 1 56 LEU 56 468 468 LEU LEU A . n A 1 57 ARG 57 469 469 ARG ARG A . n A 1 58 LYS 58 470 470 LYS LYS A . n A 1 59 TYR 59 471 471 TYR TYR A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-07-10 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 700 _pdbx_database_remark.text ;SHEET DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 ILE A 434 ? ? -41.63 155.34 2 3 SER A 415 ? ? -41.30 107.43 3 3 LEU A 433 ? ? -86.23 39.99 4 5 LYS A 453 ? ? -109.82 79.93 5 6 SER A 417 ? ? -108.85 75.95 6 6 LEU A 433 ? ? -85.96 38.65 7 7 SER A 417 ? ? -37.21 135.58 8 7 GLU A 432 ? ? -35.13 -33.07 9 7 LEU A 433 ? ? -84.77 38.28 10 8 LEU A 433 ? ? -82.52 38.87 11 8 LYS A 458 ? ? -121.56 -57.12 12 9 ASN A 435 ? ? 44.96 28.63 13 9 LYS A 458 ? ? -84.09 44.05 14 10 LEU A 433 ? ? -91.48 31.92 15 10 ALA A 465 ? ? -39.74 -25.36 16 11 SER A 417 ? ? -101.19 63.39 17 11 LEU A 433 ? ? -91.68 31.02 18 12 GLU A 432 ? ? -34.87 -34.85 19 12 LEU A 433 ? ? -87.47 39.66 20 12 LYS A 470 ? ? -83.48 38.18 21 13 PHE A 420 ? ? -47.71 161.60 22 13 LYS A 458 ? ? -98.19 -60.41 23 16 SER A 415 ? ? -100.38 42.80 24 16 LEU A 433 ? ? -94.82 43.80 25 17 LYS A 458 ? ? -106.55 46.10 26 18 LEU A 433 ? ? -83.74 42.70 27 18 LYS A 458 ? ? -83.75 45.41 28 19 SER A 417 ? ? -38.62 103.92 29 19 LEU A 433 ? ? -95.38 40.18 30 19 THR A 449 ? ? -68.91 99.66 31 19 LEU A 457 ? ? -34.59 149.52 32 20 ASP A 424 ? ? -52.95 173.12 33 20 ILE A 434 ? ? -40.00 145.78 34 20 LEU A 457 ? ? -48.34 104.17 #