data_2EE9 # _entry.id 2EE9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EE9 pdb_00002ee9 10.2210/pdb2ee9/pdb RCSB RCSB026556 ? ? WWPDB D_1000026556 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk003002600.11 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EE9 _pdbx_database_status.recvd_initial_deposition_date 2007-02-15 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tomizawa, T.' 1 'Koshiba, S.' 2 'Watanabe, S.' 3 'Harada, T.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the 16th filamin domain from human Filamin-B' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tomizawa, T.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Watanabe, S.' 3 ? primary 'Harada, T.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Filamin-B _entity.formula_weight 10179.408 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'filamin domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;FLN-B, Beta-filamin, Actin-binding-like protein, Thyroid autoantigen, Truncated actin-binding protein, Truncated ABP, ABP- 280 homolog, ABP-278, Filamin 3, Filamin homolog 1, Fh1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIP ESPLQFYVNYPNSGS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIP ESPLQFYVNYPNSGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk003002600.11 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 VAL n 1 9 SER n 1 10 ASP n 1 11 MET n 1 12 ASN n 1 13 GLY n 1 14 LEU n 1 15 GLY n 1 16 PHE n 1 17 LYS n 1 18 PRO n 1 19 PHE n 1 20 ASP n 1 21 LEU n 1 22 VAL n 1 23 ILE n 1 24 PRO n 1 25 PHE n 1 26 ALA n 1 27 VAL n 1 28 ARG n 1 29 LYS n 1 30 GLY n 1 31 GLU n 1 32 ILE n 1 33 THR n 1 34 GLY n 1 35 GLU n 1 36 VAL n 1 37 HIS n 1 38 MET n 1 39 PRO n 1 40 SER n 1 41 GLY n 1 42 LYS n 1 43 THR n 1 44 ALA n 1 45 THR n 1 46 PRO n 1 47 GLU n 1 48 ILE n 1 49 VAL n 1 50 ASP n 1 51 ASN n 1 52 LYS n 1 53 ASP n 1 54 GLY n 1 55 THR n 1 56 VAL n 1 57 THR n 1 58 VAL n 1 59 ARG n 1 60 TYR n 1 61 ALA n 1 62 PRO n 1 63 THR n 1 64 GLU n 1 65 VAL n 1 66 GLY n 1 67 LEU n 1 68 HIS n 1 69 GLU n 1 70 MET n 1 71 HIS n 1 72 ILE n 1 73 LYS n 1 74 TYR n 1 75 MET n 1 76 GLY n 1 77 SER n 1 78 HIS n 1 79 ILE n 1 80 PRO n 1 81 GLU n 1 82 SER n 1 83 PRO n 1 84 LEU n 1 85 GLN n 1 86 PHE n 1 87 TYR n 1 88 VAL n 1 89 ASN n 1 90 TYR n 1 91 PRO n 1 92 ASN n 1 93 SER n 1 94 GLY n 1 95 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene FLNB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060619-09 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FLNB_HUMAN _struct_ref.pdbx_db_accession O75369 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFY VNYPNSGS ; _struct_ref.pdbx_align_begin 1736 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EE9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 95 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O75369 _struct_ref_seq.db_align_beg 1736 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1823 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 95 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EE9 GLY A 1 ? UNP O75369 ? ? 'expression tag' 1 1 1 2EE9 SER A 2 ? UNP O75369 ? ? 'expression tag' 2 2 1 2EE9 SER A 3 ? UNP O75369 ? ? 'expression tag' 3 3 1 2EE9 GLY A 4 ? UNP O75369 ? ? 'expression tag' 4 4 1 2EE9 SER A 5 ? UNP O75369 ? ? 'expression tag' 5 5 1 2EE9 SER A 6 ? UNP O75369 ? ? 'expression tag' 6 6 1 2EE9 GLY A 7 ? UNP O75369 ? ? 'expression tag' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.21mM filamin domain U-15N,13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE II' _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2EE9 _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2EE9 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EE9 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection TopSpin 1.3 Bruker 1 processing NMRPipe 20060524 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9823 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2EE9 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EE9 _struct.title 'Solution structure of the 16th filamin domain from human Filamin-B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EE9 _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text ;beta-sandwich, immunoglobulin-like fold, filamin, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 1 0.04 2 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 2 -0.02 3 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 3 0.08 4 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 4 0.03 5 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 5 -0.06 6 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 6 0.00 7 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 7 -0.02 8 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 8 -0.02 9 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 9 0.02 10 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 10 -0.01 11 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 11 -0.05 12 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 12 -0.04 13 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 13 -0.06 14 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 14 -0.07 15 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 15 -0.01 16 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 16 -0.01 17 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 17 0.04 18 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 18 -0.03 19 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 19 0.01 20 SER 82 A . ? SER 82 A PRO 83 A ? PRO 83 A 20 -0.06 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 20 ? VAL A 22 ? ASP A 20 VAL A 22 A 2 VAL A 56 ? ARG A 59 ? VAL A 56 ARG A 59 A 3 GLU A 47 ? ASP A 50 ? GLU A 47 ASP A 50 B 1 THR A 43 ? ALA A 44 ? THR A 43 ALA A 44 B 2 ILE A 32 ? HIS A 37 ? ILE A 32 HIS A 37 B 3 GLY A 66 ? TYR A 74 ? GLY A 66 TYR A 74 B 4 LEU A 84 ? VAL A 88 ? LEU A 84 VAL A 88 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 21 ? N LEU A 21 O VAL A 58 ? O VAL A 58 A 2 3 O THR A 57 ? O THR A 57 N VAL A 49 ? N VAL A 49 B 1 2 O ALA A 44 ? O ALA A 44 N VAL A 36 ? N VAL A 36 B 2 3 N GLU A 35 ? N GLU A 35 O HIS A 71 ? O HIS A 71 B 3 4 N GLY A 66 ? N GLY A 66 O VAL A 88 ? O VAL A 88 # _database_PDB_matrix.entry_id 2EE9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2EE9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 MET 75 75 75 MET MET A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 HIS 78 78 78 HIS HIS A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 SER 95 95 95 SER SER A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -173.53 123.78 2 1 SER A 3 ? ? -40.66 105.98 3 1 LYS A 29 ? ? -36.43 123.40 4 1 GLU A 31 ? ? -85.99 33.64 5 1 PRO A 46 ? ? -69.72 -170.87 6 2 SER A 5 ? ? -50.64 173.73 7 2 GLU A 31 ? ? -85.85 33.70 8 2 PRO A 46 ? ? -69.75 -178.26 9 2 ASP A 53 ? ? -120.27 -56.05 10 3 LEU A 14 ? ? -86.72 31.64 11 3 LYS A 29 ? ? -94.98 58.88 12 3 PRO A 46 ? ? -69.74 -171.56 13 3 PRO A 80 ? ? -69.79 1.35 14 3 PRO A 91 ? ? -69.77 99.80 15 4 SER A 9 ? ? -44.54 92.54 16 4 ARG A 28 ? ? -117.91 60.88 17 4 LYS A 29 ? ? 34.32 37.79 18 4 GLU A 31 ? ? -83.83 35.32 19 4 PRO A 80 ? ? -69.82 2.89 20 4 PRO A 91 ? ? -69.79 3.96 21 5 ASN A 12 ? ? -169.28 106.47 22 5 LYS A 29 ? ? -78.92 49.05 23 5 GLU A 31 ? ? -91.39 33.76 24 5 PRO A 46 ? ? -69.71 -170.31 25 5 PRO A 80 ? ? -69.75 2.95 26 6 ARG A 28 ? ? -64.61 -174.88 27 6 GLU A 31 ? ? -83.94 34.01 28 6 PRO A 80 ? ? -69.72 0.50 29 6 PRO A 91 ? ? -69.80 92.82 30 7 PHE A 16 ? ? -39.34 154.79 31 7 PRO A 46 ? ? -69.75 -177.73 32 7 LYS A 52 ? ? -88.09 34.05 33 7 PRO A 91 ? ? -69.79 -176.28 34 8 SER A 2 ? ? -52.11 97.42 35 8 GLU A 31 ? ? -84.39 33.23 36 8 PRO A 80 ? ? -69.80 3.18 37 8 PRO A 91 ? ? -69.73 0.67 38 9 LEU A 14 ? ? -68.64 84.65 39 9 GLU A 31 ? ? -97.82 33.54 40 9 PRO A 80 ? ? -69.72 3.51 41 10 GLU A 31 ? ? -86.46 34.02 42 10 PRO A 46 ? ? -69.80 -174.20 43 10 PRO A 80 ? ? -69.81 3.20 44 10 PRO A 91 ? ? -69.72 97.55 45 11 SER A 2 ? ? -81.99 43.92 46 11 GLU A 31 ? ? -85.05 33.96 47 11 PRO A 46 ? ? -69.78 -171.80 48 11 PRO A 80 ? ? -69.76 3.33 49 12 SER A 3 ? ? -172.91 127.00 50 12 LYS A 29 ? ? -57.92 95.88 51 12 PRO A 80 ? ? -69.83 2.85 52 13 SER A 6 ? ? 37.80 44.94 53 13 ASP A 10 ? ? -92.15 52.35 54 13 LYS A 29 ? ? -58.28 81.81 55 13 ASN A 92 ? ? -38.10 143.35 56 14 VAL A 8 ? ? 29.66 39.50 57 14 ARG A 28 ? ? -133.48 -74.73 58 14 LYS A 52 ? ? -84.60 31.22 59 14 PRO A 80 ? ? -69.75 3.19 60 15 PRO A 18 ? ? -69.77 -177.09 61 15 GLU A 31 ? ? -92.27 33.17 62 15 PRO A 46 ? ? -69.70 -178.70 63 15 ASN A 51 ? ? -55.81 177.50 64 15 PRO A 80 ? ? -69.80 3.33 65 15 ASN A 92 ? ? -97.41 -67.11 66 16 MET A 11 ? ? -107.65 40.22 67 16 GLU A 31 ? ? -89.95 33.24 68 16 PRO A 46 ? ? -69.80 -177.59 69 16 ASN A 51 ? ? -44.89 168.03 70 16 PRO A 80 ? ? -69.84 0.53 71 17 VAL A 8 ? ? -112.89 75.65 72 17 SER A 9 ? ? -66.24 94.88 73 17 LYS A 17 ? ? -37.44 135.55 74 17 PRO A 46 ? ? -69.77 -175.29 75 17 ASN A 51 ? ? -51.43 172.18 76 17 LYS A 52 ? ? -90.76 33.71 77 17 PRO A 80 ? ? -69.71 2.83 78 17 PRO A 91 ? ? -69.78 3.10 79 18 VAL A 8 ? ? -35.44 149.88 80 18 LYS A 29 ? ? -67.88 88.28 81 18 PRO A 46 ? ? -69.75 -179.23 82 18 ASN A 51 ? ? -49.86 174.91 83 18 ASN A 92 ? ? -40.16 109.42 84 19 SER A 6 ? ? -36.41 119.44 85 19 LEU A 14 ? ? -170.24 139.17 86 19 GLU A 31 ? ? -93.76 31.37 87 19 ASN A 51 ? ? -48.71 164.53 88 19 LYS A 52 ? ? -85.08 31.98 89 19 PRO A 80 ? ? -69.72 0.49 90 20 SER A 6 ? ? -174.98 136.55 91 20 GLU A 31 ? ? -96.56 32.63 92 20 PRO A 46 ? ? -69.76 -170.56 93 20 ASN A 51 ? ? -55.03 171.57 94 20 ASP A 53 ? ? -126.63 -54.72 95 20 ASN A 92 ? ? -83.53 44.71 #