data_2EKI # _entry.id 2EKI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EKI pdb_00002eki 10.2210/pdb2eki/pdb RCSB RCSB026776 ? ? WWPDB D_1000026776 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk003000406.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EKI _pdbx_database_status.recvd_initial_deposition_date 2007-03-23 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sato, M.' 1 'Koshiba, S.' 2 'Watanabe, S.' 3 'Harada, T.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structures of the TGS domain of human developmentally-regulated GTP-binding protein 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sato, M.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Watanabe, S.' 3 ? primary 'Harada, T.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Developmentally-regulated GTP-binding protein 1' _entity.formula_weight 10381.958 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'TGS domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DRG 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDED VIQIVKKSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDED VIQIVKKSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk003000406.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 TYR n 1 9 LEU n 1 10 LYS n 1 11 LEU n 1 12 VAL n 1 13 ARG n 1 14 ILE n 1 15 TYR n 1 16 THR n 1 17 LYS n 1 18 PRO n 1 19 LYS n 1 20 GLY n 1 21 GLN n 1 22 LEU n 1 23 PRO n 1 24 ASP n 1 25 TYR n 1 26 THR n 1 27 SER n 1 28 PRO n 1 29 VAL n 1 30 VAL n 1 31 LEU n 1 32 PRO n 1 33 TYR n 1 34 SER n 1 35 ARG n 1 36 THR n 1 37 THR n 1 38 VAL n 1 39 GLU n 1 40 ASP n 1 41 PHE n 1 42 CYS n 1 43 MET n 1 44 LYS n 1 45 ILE n 1 46 HIS n 1 47 LYS n 1 48 ASN n 1 49 LEU n 1 50 ILE n 1 51 LYS n 1 52 GLU n 1 53 PHE n 1 54 LYS n 1 55 TYR n 1 56 ALA n 1 57 LEU n 1 58 VAL n 1 59 TRP n 1 60 GLY n 1 61 LEU n 1 62 SER n 1 63 VAL n 1 64 LYS n 1 65 HIS n 1 66 ASN n 1 67 PRO n 1 68 GLN n 1 69 LYS n 1 70 VAL n 1 71 GLY n 1 72 LYS n 1 73 ASP n 1 74 HIS n 1 75 THR n 1 76 LEU n 1 77 GLU n 1 78 ASP n 1 79 GLU n 1 80 ASP n 1 81 VAL n 1 82 ILE n 1 83 GLN n 1 84 ILE n 1 85 VAL n 1 86 LYS n 1 87 LYS n 1 88 SER n 1 89 GLY n 1 90 PRO n 1 91 SER n 1 92 SER n 1 93 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene DRG1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P051011-16 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DRG1_HUMAN _struct_ref.pdbx_db_accession Q9Y295 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;YLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK ; _struct_ref.pdbx_align_begin 288 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EKI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y295 _struct_ref_seq.db_align_beg 288 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 367 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EKI GLY A 1 ? UNP Q9Y295 ? ? 'expression tag' 1 1 1 2EKI SER A 2 ? UNP Q9Y295 ? ? 'expression tag' 2 2 1 2EKI SER A 3 ? UNP Q9Y295 ? ? 'expression tag' 3 3 1 2EKI GLY A 4 ? UNP Q9Y295 ? ? 'expression tag' 4 4 1 2EKI SER A 5 ? UNP Q9Y295 ? ? 'expression tag' 5 5 1 2EKI SER A 6 ? UNP Q9Y295 ? ? 'expression tag' 6 6 1 2EKI GLY A 7 ? UNP Q9Y295 ? ? 'expression tag' 7 7 1 2EKI SER A 88 ? UNP Q9Y295 ? ? 'expression tag' 88 8 1 2EKI GLY A 89 ? UNP Q9Y295 ? ? 'expression tag' 89 9 1 2EKI PRO A 90 ? UNP Q9Y295 ? ? 'expression tag' 90 10 1 2EKI SER A 91 ? UNP Q9Y295 ? ? 'expression tag' 91 11 1 2EKI SER A 92 ? UNP Q9Y295 ? ? 'expression tag' 92 12 1 2EKI GLY A 93 ? UNP Q9Y295 ? ? 'expression tag' 93 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM TGS domain U-15N, 13C; 20mM d-Tris HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2EKI _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2EKI _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EKI _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9827 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2EKI _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EKI _struct.title 'Solution structures of the TGS domain of human developmentally-regulated GTP-binding protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EKI _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;DRG 1, Protein NEDD3, Neural precursor cell expressed developmentally down-regulated protein 3, Drg, Nedd-3, Nedd3, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 37 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 46 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 37 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 46 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 1 -0.01 2 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 2 -0.05 3 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 3 -0.07 4 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 4 -0.09 5 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 5 -0.09 6 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 6 -0.02 7 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 7 0.03 8 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 8 -0.07 9 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 9 0.04 10 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 10 -0.05 11 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 11 -0.05 12 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 12 0.00 13 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 13 -0.03 14 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 14 -0.07 15 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 15 -0.13 16 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 16 -0.06 17 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 17 -0.03 18 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 18 -0.02 19 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 19 -0.04 20 ASN 66 A . ? ASN 66 A PRO 67 A ? PRO 67 A 20 -0.08 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 29 ? PRO A 32 ? VAL A 29 PRO A 32 A 2 LEU A 11 ? THR A 16 ? LEU A 11 THR A 16 A 3 ASP A 80 ? ILE A 82 ? ASP A 80 ILE A 82 B 1 GLN A 68 ? VAL A 70 ? GLN A 68 VAL A 70 B 2 PHE A 53 ? VAL A 58 ? PHE A 53 VAL A 58 B 3 ILE A 84 ? LYS A 86 ? ILE A 84 LYS A 86 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 31 ? O LEU A 31 N VAL A 12 ? N VAL A 12 A 2 3 N TYR A 15 ? N TYR A 15 O ASP A 80 ? O ASP A 80 B 1 2 O VAL A 70 ? O VAL A 70 N ALA A 56 ? N ALA A 56 B 2 3 N LYS A 54 ? N LYS A 54 O VAL A 85 ? O VAL A 85 # _database_PDB_matrix.entry_id 2EKI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2EKI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLY 93 93 93 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-09-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -38.18 104.01 2 1 LYS A 19 ? ? -38.29 135.58 3 1 SER A 62 ? ? -36.22 -39.92 4 1 LYS A 87 ? ? -41.84 151.31 5 2 LEU A 9 ? ? -51.44 96.46 6 2 PRO A 18 ? ? -69.70 -173.47 7 2 SER A 27 ? ? -118.60 58.91 8 2 SER A 34 ? ? -38.78 -32.25 9 2 VAL A 38 ? ? -37.90 -37.78 10 2 LYS A 54 ? ? -90.76 -65.39 11 2 GLU A 79 ? ? 37.87 48.38 12 2 LYS A 87 ? ? -43.05 166.38 13 3 PRO A 18 ? ? -69.80 -166.84 14 3 SER A 34 ? ? -38.01 -33.05 15 3 ILE A 45 ? ? -76.71 -71.93 16 4 SER A 2 ? ? -106.74 42.77 17 4 LYS A 19 ? ? -58.17 104.35 18 5 SER A 3 ? ? -38.59 136.68 19 5 LEU A 9 ? ? -64.11 85.98 20 5 LYS A 19 ? ? -60.48 98.97 21 5 PRO A 28 ? ? -69.72 -167.20 22 5 ILE A 45 ? ? -80.56 -70.28 23 5 LYS A 54 ? ? -101.95 -63.21 24 5 SER A 62 ? ? -37.10 -36.19 25 5 SER A 91 ? ? -83.35 40.22 26 6 ASP A 24 ? ? -49.59 108.65 27 6 SER A 62 ? ? -39.08 -26.16 28 7 ASP A 24 ? ? -49.89 154.14 29 7 SER A 34 ? ? -35.15 -39.15 30 7 VAL A 38 ? ? -33.94 -34.56 31 7 ILE A 45 ? ? -95.28 -67.32 32 7 ILE A 50 ? ? -37.44 -34.24 33 7 LYS A 54 ? ? -105.82 -63.62 34 7 SER A 62 ? ? -34.54 -37.56 35 7 LYS A 87 ? ? -36.44 153.12 36 7 SER A 88 ? ? -43.97 161.30 37 8 TYR A 8 ? ? 41.13 26.99 38 8 LYS A 19 ? ? -34.31 112.39 39 8 SER A 34 ? ? -34.67 -35.36 40 8 SER A 62 ? ? -36.63 -33.65 41 9 SER A 27 ? ? -118.42 59.51 42 9 ILE A 45 ? ? -93.11 -68.57 43 9 ILE A 50 ? ? -38.22 -38.24 44 9 LYS A 87 ? ? -34.81 122.82 45 9 PRO A 90 ? ? -69.82 2.76 46 10 SER A 27 ? ? -117.29 53.10 47 10 SER A 34 ? ? -34.39 -37.40 48 10 THR A 37 ? ? -171.93 143.78 49 10 SER A 62 ? ? -36.68 -39.49 50 10 LYS A 87 ? ? -38.01 150.05 51 10 SER A 92 ? ? -43.22 161.04 52 11 TYR A 8 ? ? -90.56 32.28 53 11 LEU A 9 ? ? -59.72 82.44 54 11 PRO A 28 ? ? -69.69 -170.76 55 11 SER A 34 ? ? -34.24 -38.80 56 11 LYS A 87 ? ? -62.91 87.26 57 12 LYS A 10 ? ? -47.56 152.24 58 12 LYS A 19 ? ? -53.90 108.87 59 12 SER A 27 ? ? -117.48 53.31 60 12 SER A 34 ? ? -39.41 -38.26 61 12 ILE A 45 ? ? -99.22 -69.59 62 13 LEU A 9 ? ? -55.49 97.48 63 13 SER A 34 ? ? -36.26 -36.48 64 13 ILE A 45 ? ? -90.89 -67.56 65 13 LYS A 87 ? ? -46.86 161.43 66 14 SER A 2 ? ? 37.72 41.46 67 14 PRO A 28 ? ? -69.77 -177.87 68 14 CYS A 42 ? ? -38.99 -32.68 69 14 ILE A 45 ? ? -90.04 -63.81 70 14 SER A 88 ? ? -168.59 116.34 71 15 SER A 5 ? ? 37.45 46.22 72 15 TYR A 8 ? ? -84.62 34.73 73 15 LYS A 10 ? ? -43.31 150.64 74 15 SER A 27 ? ? -115.95 57.76 75 15 SER A 34 ? ? -35.46 -35.85 76 15 ILE A 45 ? ? -84.44 -70.30 77 15 PHE A 53 ? ? -38.17 137.01 78 15 SER A 92 ? ? -51.40 101.08 79 16 LYS A 19 ? ? -64.43 74.33 80 16 SER A 27 ? ? -116.69 57.22 81 16 ILE A 45 ? ? -92.64 -68.30 82 17 SER A 3 ? ? -89.05 40.97 83 17 SER A 6 ? ? -44.53 108.87 84 17 ILE A 45 ? ? -88.01 -72.88 85 18 PRO A 18 ? ? -69.69 -173.61 86 18 SER A 62 ? ? -37.60 -30.21 87 18 PRO A 90 ? ? -69.76 94.73 88 19 LEU A 9 ? ? -61.27 88.63 89 19 LYS A 87 ? ? -43.94 102.67 90 19 SER A 91 ? ? -36.71 145.19 91 20 SER A 34 ? ? -39.14 -28.17 92 20 SER A 62 ? ? -39.50 -25.74 93 20 SER A 88 ? ? -101.11 42.85 #