data_2ELN # _entry.id 2ELN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2ELN pdb_00002eln 10.2210/pdb2eln/pdb RCSB RCSB026817 ? ? WWPDB D_1000026817 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-01 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 2ELN _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-03-27 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ar_001000685.10 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tochio, N.' 1 'Yoneyama, M.' 2 'Koshiba, S.' 3 'Watanabe, S.' 4 'Harada, T.' 5 'Umehara, T.' 6 'Tanaka, A.' 7 'Kigawa, T.' 8 'Yokoyama, S.' 9 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 10 # _citation.id primary _citation.title 'Solution structure of the 11th C2H2 zinc finger of human Zinc finger protein 406' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tochio, N.' 1 ? primary 'Yoneyama, M.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Watanabe, S.' 4 ? primary 'Harada, T.' 5 ? primary 'Umehara, T.' 6 ? primary 'Tanaka, A.' 7 ? primary 'Kigawa, T.' 8 ? primary 'Yokoyama, S.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein 406' 4013.512 1 ? ? 'zf-C2H2 domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ZFAT zinc finger 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGILLKCPTDGCDYSTPDKYKLQAHLKVHTALD _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGILLKCPTDGCDYSTPDKYKLQAHLKVHTALD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ar_001000685.10 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ILE n 1 9 LEU n 1 10 LEU n 1 11 LYS n 1 12 CYS n 1 13 PRO n 1 14 THR n 1 15 ASP n 1 16 GLY n 1 17 CYS n 1 18 ASP n 1 19 TYR n 1 20 SER n 1 21 THR n 1 22 PRO n 1 23 ASP n 1 24 LYS n 1 25 TYR n 1 26 LYS n 1 27 LEU n 1 28 GLN n 1 29 ALA n 1 30 HIS n 1 31 LEU n 1 32 LYS n 1 33 VAL n 1 34 HIS n 1 35 THR n 1 36 ALA n 1 37 LEU n 1 38 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ZFAT1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060718-05 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ASP 38 38 38 ASP ASP A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 181 _pdbx_nonpoly_scheme.auth_seq_num 181 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2ELN _exptl.crystals_number ? # _struct.entry_id 2ELN _struct.title 'Solution structure of the 11th C2H2 zinc finger of human Zinc finger protein 406' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ELN _struct_keywords.text ;ZFAT zinc finger 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZN406_HUMAN _struct_ref.pdbx_db_accession Q9P243 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ILLKCPTDGCDYSTPDKYKLQAHLKVHTALD _struct_ref.pdbx_align_begin 796 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ELN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 38 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9P243 _struct_ref_seq.db_align_beg 796 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 826 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 38 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2ELN GLY A 1 ? UNP Q9P243 ? ? 'expression tag' 1 1 1 2ELN SER A 2 ? UNP Q9P243 ? ? 'expression tag' 2 2 1 2ELN SER A 3 ? UNP Q9P243 ? ? 'expression tag' 3 3 1 2ELN GLY A 4 ? UNP Q9P243 ? ? 'expression tag' 4 4 1 2ELN SER A 5 ? UNP Q9P243 ? ? 'expression tag' 5 5 1 2ELN SER A 6 ? UNP Q9P243 ? ? 'expression tag' 6 6 1 2ELN GLY A 7 ? UNP Q9P243 ? ? 'expression tag' 7 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 23 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id THR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 35 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 23 _struct_conf.end_auth_comp_id THR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 35 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 12 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 12 A ZN 181 1_555 ? ? ? ? ? ? ? 2.353 ? ? metalc2 metalc ? ? A CYS 17 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 17 A ZN 181 1_555 ? ? ? ? ? ? ? 2.318 ? ? metalc3 metalc ? ? A HIS 30 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 30 A ZN 181 1_555 ? ? ? ? ? ? ? 1.979 ? ? metalc4 metalc ? ? A HIS 34 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 34 A ZN 181 1_555 ? ? ? ? ? ? ? 1.923 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 12 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 181 ? 1_555 SG ? A CYS 17 ? A CYS 17 ? 1_555 111.9 ? 2 SG ? A CYS 12 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 181 ? 1_555 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 114.4 ? 3 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 181 ? 1_555 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 103.3 ? 4 SG ? A CYS 12 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 181 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 104.2 ? 5 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 181 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 113.5 ? 6 NE2 ? A HIS 30 ? A HIS 30 ? 1_555 ZN ? B ZN . ? A ZN 181 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 109.8 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 10 ? LYS A 11 ? LEU A 10 LYS A 11 A 2 SER A 20 ? THR A 21 ? SER A 20 THR A 21 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 10 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 10 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id THR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 21 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id THR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 21 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 181 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 181' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 LYS A 11 ? LYS A 11 . ? 1_555 ? 2 AC1 3 CYS A 12 ? CYS A 12 . ? 1_555 ? 3 AC1 3 THR A 14 ? THR A 14 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 35 ? ? -84.52 35.70 2 3 THR A 14 ? ? -49.63 107.41 3 3 LEU A 37 ? ? -109.74 -64.57 4 4 SER A 3 ? ? -85.88 43.12 5 4 THR A 14 ? ? -50.63 106.41 6 4 HIS A 34 ? ? -81.75 -70.90 7 4 LEU A 37 ? ? -53.29 92.19 8 5 HIS A 34 ? ? -94.51 -71.04 9 6 SER A 6 ? ? -107.00 44.45 10 6 PRO A 22 ? ? -69.72 3.28 11 6 THR A 35 ? ? -91.77 43.94 12 7 SER A 6 ? ? -174.91 125.22 13 7 ASP A 18 ? ? -103.10 41.83 14 7 PRO A 22 ? ? -69.78 3.60 15 7 VAL A 33 ? ? -49.66 -19.74 16 7 HIS A 34 ? ? -93.11 35.69 17 8 THR A 14 ? ? -38.77 127.44 18 8 ASP A 18 ? ? -108.50 43.61 19 8 HIS A 34 ? ? -90.72 -63.98 20 9 THR A 35 ? ? -87.02 38.31 21 10 THR A 35 ? ? -85.71 42.46 22 10 LEU A 37 ? ? -129.13 -59.40 23 11 THR A 35 ? ? -86.67 39.71 24 12 ASP A 18 ? ? -106.61 41.23 25 12 ALA A 36 ? ? -69.95 72.31 26 13 SER A 2 ? ? -100.11 42.16 27 13 CYS A 12 ? ? -36.87 136.35 28 13 THR A 14 ? ? -53.58 106.56 29 13 PRO A 22 ? ? -69.73 2.95 30 13 THR A 35 ? ? -89.14 35.43 31 13 LEU A 37 ? ? -87.28 43.93 32 14 LEU A 9 ? ? -37.50 130.93 33 14 THR A 14 ? ? -49.00 108.46 34 14 THR A 35 ? ? -87.98 41.14 35 15 ILE A 8 ? ? -36.78 123.20 36 15 THR A 14 ? ? -34.02 124.08 37 15 ASP A 18 ? ? -109.83 41.95 38 15 PRO A 22 ? ? -69.73 2.62 39 16 ILE A 8 ? ? -83.98 48.11 40 16 PRO A 22 ? ? -69.73 0.36 41 16 THR A 35 ? ? -87.20 38.08 42 16 ALA A 36 ? ? -119.07 79.95 43 16 LEU A 37 ? ? -91.63 42.62 44 17 ILE A 8 ? ? -82.67 47.78 45 17 VAL A 33 ? ? -48.26 -19.85 46 18 SER A 2 ? ? -121.05 -56.84 47 18 ILE A 8 ? ? 34.35 48.10 48 18 THR A 14 ? ? -50.58 108.23 49 18 THR A 35 ? ? -82.51 38.45 50 19 CYS A 12 ? ? -36.70 135.31 51 19 THR A 35 ? ? -85.10 39.50 52 19 LEU A 37 ? ? -129.49 -60.53 53 20 SER A 2 ? ? -132.92 -54.58 54 20 SER A 6 ? ? -36.91 129.09 55 20 CYS A 12 ? ? -39.17 136.35 56 20 HIS A 34 ? ? -84.59 -70.83 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.entry_id 2ELN _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2ELN # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.2mM sample U-15N,13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZnCl2; 1mM IDA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2ELN _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASP N N N N 14 ASP CA C N S 15 ASP C C N N 16 ASP O O N N 17 ASP CB C N N 18 ASP CG C N N 19 ASP OD1 O N N 20 ASP OD2 O N N 21 ASP OXT O N N 22 ASP H H N N 23 ASP H2 H N N 24 ASP HA H N N 25 ASP HB2 H N N 26 ASP HB3 H N N 27 ASP HD2 H N N 28 ASP HXT H N N 29 CYS N N N N 30 CYS CA C N R 31 CYS C C N N 32 CYS O O N N 33 CYS CB C N N 34 CYS SG S N N 35 CYS OXT O N N 36 CYS H H N N 37 CYS H2 H N N 38 CYS HA H N N 39 CYS HB2 H N N 40 CYS HB3 H N N 41 CYS HG H N N 42 CYS HXT H N N 43 GLN N N N N 44 GLN CA C N S 45 GLN C C N N 46 GLN O O N N 47 GLN CB C N N 48 GLN CG C N N 49 GLN CD C N N 50 GLN OE1 O N N 51 GLN NE2 N N N 52 GLN OXT O N N 53 GLN H H N N 54 GLN H2 H N N 55 GLN HA H N N 56 GLN HB2 H N N 57 GLN HB3 H N N 58 GLN HG2 H N N 59 GLN HG3 H N N 60 GLN HE21 H N N 61 GLN HE22 H N N 62 GLN HXT H N N 63 GLY N N N N 64 GLY CA C N N 65 GLY C C N N 66 GLY O O N N 67 GLY OXT O N N 68 GLY H H N N 69 GLY H2 H N N 70 GLY HA2 H N N 71 GLY HA3 H N N 72 GLY HXT H N N 73 HIS N N N N 74 HIS CA C N S 75 HIS C C N N 76 HIS O O N N 77 HIS CB C N N 78 HIS CG C Y N 79 HIS ND1 N Y N 80 HIS CD2 C Y N 81 HIS CE1 C Y N 82 HIS NE2 N Y N 83 HIS OXT O N N 84 HIS H H N N 85 HIS H2 H N N 86 HIS HA H N N 87 HIS HB2 H N N 88 HIS HB3 H N N 89 HIS HD1 H N N 90 HIS HD2 H N N 91 HIS HE1 H N N 92 HIS HE2 H N N 93 HIS HXT H N N 94 ILE N N N N 95 ILE CA C N S 96 ILE C C N N 97 ILE O O N N 98 ILE CB C N S 99 ILE CG1 C N N 100 ILE CG2 C N N 101 ILE CD1 C N N 102 ILE OXT O N N 103 ILE H H N N 104 ILE H2 H N N 105 ILE HA H N N 106 ILE HB H N N 107 ILE HG12 H N N 108 ILE HG13 H N N 109 ILE HG21 H N N 110 ILE HG22 H N N 111 ILE HG23 H N N 112 ILE HD11 H N N 113 ILE HD12 H N N 114 ILE HD13 H N N 115 ILE HXT H N N 116 LEU N N N N 117 LEU CA C N S 118 LEU C C N N 119 LEU O O N N 120 LEU CB C N N 121 LEU CG C N N 122 LEU CD1 C N N 123 LEU CD2 C N N 124 LEU OXT O N N 125 LEU H H N N 126 LEU H2 H N N 127 LEU HA H N N 128 LEU HB2 H N N 129 LEU HB3 H N N 130 LEU HG H N N 131 LEU HD11 H N N 132 LEU HD12 H N N 133 LEU HD13 H N N 134 LEU HD21 H N N 135 LEU HD22 H N N 136 LEU HD23 H N N 137 LEU HXT H N N 138 LYS N N N N 139 LYS CA C N S 140 LYS C C N N 141 LYS O O N N 142 LYS CB C N N 143 LYS CG C N N 144 LYS CD C N N 145 LYS CE C N N 146 LYS NZ N N N 147 LYS OXT O N N 148 LYS H H N N 149 LYS H2 H N N 150 LYS HA H N N 151 LYS HB2 H N N 152 LYS HB3 H N N 153 LYS HG2 H N N 154 LYS HG3 H N N 155 LYS HD2 H N N 156 LYS HD3 H N N 157 LYS HE2 H N N 158 LYS HE3 H N N 159 LYS HZ1 H N N 160 LYS HZ2 H N N 161 LYS HZ3 H N N 162 LYS HXT H N N 163 PRO N N N N 164 PRO CA C N S 165 PRO C C N N 166 PRO O O N N 167 PRO CB C N N 168 PRO CG C N N 169 PRO CD C N N 170 PRO OXT O N N 171 PRO H H N N 172 PRO HA H N N 173 PRO HB2 H N N 174 PRO HB3 H N N 175 PRO HG2 H N N 176 PRO HG3 H N N 177 PRO HD2 H N N 178 PRO HD3 H N N 179 PRO HXT H N N 180 SER N N N N 181 SER CA C N S 182 SER C C N N 183 SER O O N N 184 SER CB C N N 185 SER OG O N N 186 SER OXT O N N 187 SER H H N N 188 SER H2 H N N 189 SER HA H N N 190 SER HB2 H N N 191 SER HB3 H N N 192 SER HG H N N 193 SER HXT H N N 194 THR N N N N 195 THR CA C N S 196 THR C C N N 197 THR O O N N 198 THR CB C N R 199 THR OG1 O N N 200 THR CG2 C N N 201 THR OXT O N N 202 THR H H N N 203 THR H2 H N N 204 THR HA H N N 205 THR HB H N N 206 THR HG1 H N N 207 THR HG21 H N N 208 THR HG22 H N N 209 THR HG23 H N N 210 THR HXT H N N 211 TYR N N N N 212 TYR CA C N S 213 TYR C C N N 214 TYR O O N N 215 TYR CB C N N 216 TYR CG C Y N 217 TYR CD1 C Y N 218 TYR CD2 C Y N 219 TYR CE1 C Y N 220 TYR CE2 C Y N 221 TYR CZ C Y N 222 TYR OH O N N 223 TYR OXT O N N 224 TYR H H N N 225 TYR H2 H N N 226 TYR HA H N N 227 TYR HB2 H N N 228 TYR HB3 H N N 229 TYR HD1 H N N 230 TYR HD2 H N N 231 TYR HE1 H N N 232 TYR HE2 H N N 233 TYR HH H N N 234 TYR HXT H N N 235 VAL N N N N 236 VAL CA C N S 237 VAL C C N N 238 VAL O O N N 239 VAL CB C N N 240 VAL CG1 C N N 241 VAL CG2 C N N 242 VAL OXT O N N 243 VAL H H N N 244 VAL H2 H N N 245 VAL HA H N N 246 VAL HB H N N 247 VAL HG11 H N N 248 VAL HG12 H N N 249 VAL HG13 H N N 250 VAL HG21 H N N 251 VAL HG22 H N N 252 VAL HG23 H N N 253 VAL HXT H N N 254 ZN ZN ZN N N 255 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASP N CA sing N N 13 ASP N H sing N N 14 ASP N H2 sing N N 15 ASP CA C sing N N 16 ASP CA CB sing N N 17 ASP CA HA sing N N 18 ASP C O doub N N 19 ASP C OXT sing N N 20 ASP CB CG sing N N 21 ASP CB HB2 sing N N 22 ASP CB HB3 sing N N 23 ASP CG OD1 doub N N 24 ASP CG OD2 sing N N 25 ASP OD2 HD2 sing N N 26 ASP OXT HXT sing N N 27 CYS N CA sing N N 28 CYS N H sing N N 29 CYS N H2 sing N N 30 CYS CA C sing N N 31 CYS CA CB sing N N 32 CYS CA HA sing N N 33 CYS C O doub N N 34 CYS C OXT sing N N 35 CYS CB SG sing N N 36 CYS CB HB2 sing N N 37 CYS CB HB3 sing N N 38 CYS SG HG sing N N 39 CYS OXT HXT sing N N 40 GLN N CA sing N N 41 GLN N H sing N N 42 GLN N H2 sing N N 43 GLN CA C sing N N 44 GLN CA CB sing N N 45 GLN CA HA sing N N 46 GLN C O doub N N 47 GLN C OXT sing N N 48 GLN CB CG sing N N 49 GLN CB HB2 sing N N 50 GLN CB HB3 sing N N 51 GLN CG CD sing N N 52 GLN CG HG2 sing N N 53 GLN CG HG3 sing N N 54 GLN CD OE1 doub N N 55 GLN CD NE2 sing N N 56 GLN NE2 HE21 sing N N 57 GLN NE2 HE22 sing N N 58 GLN OXT HXT sing N N 59 GLY N CA sing N N 60 GLY N H sing N N 61 GLY N H2 sing N N 62 GLY CA C sing N N 63 GLY CA HA2 sing N N 64 GLY CA HA3 sing N N 65 GLY C O doub N N 66 GLY C OXT sing N N 67 GLY OXT HXT sing N N 68 HIS N CA sing N N 69 HIS N H sing N N 70 HIS N H2 sing N N 71 HIS CA C sing N N 72 HIS CA CB sing N N 73 HIS CA HA sing N N 74 HIS C O doub N N 75 HIS C OXT sing N N 76 HIS CB CG sing N N 77 HIS CB HB2 sing N N 78 HIS CB HB3 sing N N 79 HIS CG ND1 sing Y N 80 HIS CG CD2 doub Y N 81 HIS ND1 CE1 doub Y N 82 HIS ND1 HD1 sing N N 83 HIS CD2 NE2 sing Y N 84 HIS CD2 HD2 sing N N 85 HIS CE1 NE2 sing Y N 86 HIS CE1 HE1 sing N N 87 HIS NE2 HE2 sing N N 88 HIS OXT HXT sing N N 89 ILE N CA sing N N 90 ILE N H sing N N 91 ILE N H2 sing N N 92 ILE CA C sing N N 93 ILE CA CB sing N N 94 ILE CA HA sing N N 95 ILE C O doub N N 96 ILE C OXT sing N N 97 ILE CB CG1 sing N N 98 ILE CB CG2 sing N N 99 ILE CB HB sing N N 100 ILE CG1 CD1 sing N N 101 ILE CG1 HG12 sing N N 102 ILE CG1 HG13 sing N N 103 ILE CG2 HG21 sing N N 104 ILE CG2 HG22 sing N N 105 ILE CG2 HG23 sing N N 106 ILE CD1 HD11 sing N N 107 ILE CD1 HD12 sing N N 108 ILE CD1 HD13 sing N N 109 ILE OXT HXT sing N N 110 LEU N CA sing N N 111 LEU N H sing N N 112 LEU N H2 sing N N 113 LEU CA C sing N N 114 LEU CA CB sing N N 115 LEU CA HA sing N N 116 LEU C O doub N N 117 LEU C OXT sing N N 118 LEU CB CG sing N N 119 LEU CB HB2 sing N N 120 LEU CB HB3 sing N N 121 LEU CG CD1 sing N N 122 LEU CG CD2 sing N N 123 LEU CG HG sing N N 124 LEU CD1 HD11 sing N N 125 LEU CD1 HD12 sing N N 126 LEU CD1 HD13 sing N N 127 LEU CD2 HD21 sing N N 128 LEU CD2 HD22 sing N N 129 LEU CD2 HD23 sing N N 130 LEU OXT HXT sing N N 131 LYS N CA sing N N 132 LYS N H sing N N 133 LYS N H2 sing N N 134 LYS CA C sing N N 135 LYS CA CB sing N N 136 LYS CA HA sing N N 137 LYS C O doub N N 138 LYS C OXT sing N N 139 LYS CB CG sing N N 140 LYS CB HB2 sing N N 141 LYS CB HB3 sing N N 142 LYS CG CD sing N N 143 LYS CG HG2 sing N N 144 LYS CG HG3 sing N N 145 LYS CD CE sing N N 146 LYS CD HD2 sing N N 147 LYS CD HD3 sing N N 148 LYS CE NZ sing N N 149 LYS CE HE2 sing N N 150 LYS CE HE3 sing N N 151 LYS NZ HZ1 sing N N 152 LYS NZ HZ2 sing N N 153 LYS NZ HZ3 sing N N 154 LYS OXT HXT sing N N 155 PRO N CA sing N N 156 PRO N CD sing N N 157 PRO N H sing N N 158 PRO CA C sing N N 159 PRO CA CB sing N N 160 PRO CA HA sing N N 161 PRO C O doub N N 162 PRO C OXT sing N N 163 PRO CB CG sing N N 164 PRO CB HB2 sing N N 165 PRO CB HB3 sing N N 166 PRO CG CD sing N N 167 PRO CG HG2 sing N N 168 PRO CG HG3 sing N N 169 PRO CD HD2 sing N N 170 PRO CD HD3 sing N N 171 PRO OXT HXT sing N N 172 SER N CA sing N N 173 SER N H sing N N 174 SER N H2 sing N N 175 SER CA C sing N N 176 SER CA CB sing N N 177 SER CA HA sing N N 178 SER C O doub N N 179 SER C OXT sing N N 180 SER CB OG sing N N 181 SER CB HB2 sing N N 182 SER CB HB3 sing N N 183 SER OG HG sing N N 184 SER OXT HXT sing N N 185 THR N CA sing N N 186 THR N H sing N N 187 THR N H2 sing N N 188 THR CA C sing N N 189 THR CA CB sing N N 190 THR CA HA sing N N 191 THR C O doub N N 192 THR C OXT sing N N 193 THR CB OG1 sing N N 194 THR CB CG2 sing N N 195 THR CB HB sing N N 196 THR OG1 HG1 sing N N 197 THR CG2 HG21 sing N N 198 THR CG2 HG22 sing N N 199 THR CG2 HG23 sing N N 200 THR OXT HXT sing N N 201 TYR N CA sing N N 202 TYR N H sing N N 203 TYR N H2 sing N N 204 TYR CA C sing N N 205 TYR CA CB sing N N 206 TYR CA HA sing N N 207 TYR C O doub N N 208 TYR C OXT sing N N 209 TYR CB CG sing N N 210 TYR CB HB2 sing N N 211 TYR CB HB3 sing N N 212 TYR CG CD1 doub Y N 213 TYR CG CD2 sing Y N 214 TYR CD1 CE1 sing Y N 215 TYR CD1 HD1 sing N N 216 TYR CD2 CE2 doub Y N 217 TYR CD2 HD2 sing N N 218 TYR CE1 CZ doub Y N 219 TYR CE1 HE1 sing N N 220 TYR CE2 CZ sing Y N 221 TYR CE2 HE2 sing N N 222 TYR CZ OH sing N N 223 TYR OH HH sing N N 224 TYR OXT HXT sing N N 225 VAL N CA sing N N 226 VAL N H sing N N 227 VAL N H2 sing N N 228 VAL CA C sing N N 229 VAL CA CB sing N N 230 VAL CA HA sing N N 231 VAL C O doub N N 232 VAL C OXT sing N N 233 VAL CB CG1 sing N N 234 VAL CB CG2 sing N N 235 VAL CB HB sing N N 236 VAL CG1 HG11 sing N N 237 VAL CG1 HG12 sing N N 238 VAL CG1 HG13 sing N N 239 VAL CG2 HG21 sing N N 240 VAL CG2 HG22 sing N N 241 VAL CG2 HG23 sing N N 242 VAL OXT HXT sing N N 243 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2ELN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_