data_2EQI # _entry.id 2EQI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EQI pdb_00002eqi 10.2210/pdb2eqi/pdb RCSB RCSB026983 ? ? WWPDB D_1000026983 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ar_001000485.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2EQI _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-03-30 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Nagashima, T.' 2 'Hayahsi, F.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the SH3 domain from Phospholipase C, gamma 2' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Nagashima, T.' 2 ? primary 'Hayashi, F.' 3 ? primary 'Yokoyama, S.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Phospholipase C, gamma 2' _entity.formula_weight 7574.294 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGRTVKALYDYKAKRSDELTFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGRTVKALYDYKAKRSDELTFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ar_001000485.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ARG n 1 9 THR n 1 10 VAL n 1 11 LYS n 1 12 ALA n 1 13 LEU n 1 14 TYR n 1 15 ASP n 1 16 TYR n 1 17 LYS n 1 18 ALA n 1 19 LYS n 1 20 ARG n 1 21 SER n 1 22 ASP n 1 23 GLU n 1 24 LEU n 1 25 THR n 1 26 PHE n 1 27 CYS n 1 28 ARG n 1 29 GLY n 1 30 ALA n 1 31 LEU n 1 32 ILE n 1 33 HIS n 1 34 ASN n 1 35 VAL n 1 36 SER n 1 37 LYS n 1 38 GLU n 1 39 PRO n 1 40 GLY n 1 41 GLY n 1 42 TRP n 1 43 TRP n 1 44 LYS n 1 45 GLY n 1 46 ASP n 1 47 TYR n 1 48 GLY n 1 49 THR n 1 50 ARG n 1 51 ILE n 1 52 GLN n 1 53 GLN n 1 54 TYR n 1 55 PHE n 1 56 PRO n 1 57 SER n 1 58 ASN n 1 59 TYR n 1 60 VAL n 1 61 GLU n 1 62 ASP n 1 63 ILE n 1 64 SER n 1 65 GLY n 1 66 PRO n 1 67 SER n 1 68 SER n 1 69 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene Plcg2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050815-04 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8CIH5_MOUSE _struct_ref.pdbx_db_accession Q8CIH5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RTVKALYDYKAKRSDELTFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDIS _struct_ref.pdbx_align_begin 772 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EQI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 63 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8CIH5 _struct_ref_seq.db_align_beg 772 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 827 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 63 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EQI GLY A 1 ? UNP Q8CIH5 ? ? 'expression tag' 1 1 1 2EQI SER A 2 ? UNP Q8CIH5 ? ? 'expression tag' 2 2 1 2EQI SER A 3 ? UNP Q8CIH5 ? ? 'expression tag' 3 3 1 2EQI GLY A 4 ? UNP Q8CIH5 ? ? 'expression tag' 4 4 1 2EQI SER A 5 ? UNP Q8CIH5 ? ? 'expression tag' 5 5 1 2EQI SER A 6 ? UNP Q8CIH5 ? ? 'expression tag' 6 6 1 2EQI GLY A 7 ? UNP Q8CIH5 ? ? 'expression tag' 7 7 1 2EQI SER A 64 ? UNP Q8CIH5 ? ? 'expression tag' 64 8 1 2EQI GLY A 65 ? UNP Q8CIH5 ? ? 'expression tag' 65 9 1 2EQI PRO A 66 ? UNP Q8CIH5 ? ? 'expression tag' 66 10 1 2EQI SER A 67 ? UNP Q8CIH5 ? ? 'expression tag' 67 11 1 2EQI SER A 68 ? UNP Q8CIH5 ? ? 'expression tag' 68 12 1 2EQI GLY A 69 ? UNP Q8CIH5 ? ? 'expression tag' 69 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.06mM 13C, 15N-labeled protein; 20mM d-Tris-HCl (pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2EQI _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.entry_id 2EQI _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2EQI # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C varian 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2EQI _exptl.crystals_number ? # _struct.entry_id 2EQI _struct.title 'Solution structure of the SH3 domain from Phospholipase C, gamma 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EQI _struct_keywords.text ;SH3 domain, Phospholipase C, gamma 2, PLCg2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, IMMUNE SYSTEM, HYDROLASE ; _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 56 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 58 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 56 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 58 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 31 ? HIS A 33 ? LEU A 31 HIS A 33 A 2 THR A 9 ? ALA A 12 ? THR A 9 ALA A 12 A 3 VAL A 60 ? ASP A 62 ? VAL A 60 ASP A 62 B 1 TRP A 43 ? TYR A 47 ? TRP A 43 TYR A 47 B 2 ARG A 50 ? PHE A 55 ? ARG A 50 PHE A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 32 ? O ILE A 32 N VAL A 10 ? N VAL A 10 A 2 3 N LYS A 11 ? N LYS A 11 O GLU A 61 ? O GLU A 61 B 1 2 N TYR A 47 ? N TYR A 47 O ARG A 50 ? O ARG A 50 # _atom_sites.entry_id 2EQI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 GLY 69 69 69 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-08 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 30 ? ? -48.31 169.20 2 1 LYS A 37 ? ? -48.36 94.39 3 1 GLN A 52 ? ? 38.19 53.25 4 2 PRO A 39 ? ? -69.70 93.78 5 2 GLN A 52 ? ? 38.02 44.55 6 2 SER A 67 ? ? -45.85 156.84 7 3 SER A 6 ? ? -127.64 -60.17 8 3 LYS A 37 ? ? -53.01 84.71 9 3 PRO A 66 ? ? -69.75 89.38 10 4 SER A 3 ? ? -107.50 42.58 11 4 SER A 5 ? ? -53.51 105.68 12 4 ARG A 28 ? ? -37.76 150.93 13 4 ALA A 30 ? ? -54.74 170.14 14 4 LYS A 37 ? ? -63.07 74.71 15 4 GLU A 38 ? ? -49.83 159.19 16 4 GLN A 52 ? ? 39.11 53.84 17 5 SER A 3 ? ? -133.14 -52.74 18 5 SER A 21 ? ? -122.02 -62.28 19 5 ALA A 30 ? ? -44.85 167.18 20 5 LYS A 37 ? ? -68.38 90.28 21 5 PRO A 39 ? ? -69.71 3.02 22 5 PRO A 66 ? ? -69.76 2.57 23 5 SER A 68 ? ? -85.61 42.00 24 6 SER A 5 ? ? -37.47 112.97 25 6 PHE A 26 ? ? -171.65 147.56 26 6 SER A 36 ? ? -105.34 79.78 27 6 LYS A 37 ? ? -44.00 93.83 28 6 THR A 49 ? ? -37.67 -36.20 29 6 SER A 68 ? ? -60.76 89.69 30 7 ARG A 28 ? ? -35.33 118.11 31 7 ALA A 30 ? ? -41.74 161.12 32 7 PRO A 39 ? ? -69.78 0.58 33 7 GLN A 52 ? ? 31.69 55.07 34 8 ALA A 30 ? ? -43.85 161.71 35 8 LYS A 37 ? ? -34.40 95.42 36 8 TRP A 42 ? ? -49.05 163.49 37 9 SER A 6 ? ? -45.04 164.87 38 9 ALA A 30 ? ? -52.27 172.36 39 9 SER A 36 ? ? -101.39 70.17 40 9 LYS A 37 ? ? -34.51 101.98 41 9 TYR A 54 ? ? -57.43 109.76 42 10 LYS A 37 ? ? -60.72 76.21 43 11 ARG A 20 ? ? 74.38 32.29 44 11 SER A 21 ? ? -129.53 -59.59 45 11 ALA A 30 ? ? -46.09 166.94 46 11 LYS A 37 ? ? -60.07 98.44 47 11 PRO A 39 ? ? -69.79 3.31 48 11 SER A 68 ? ? -104.90 42.24 49 12 SER A 2 ? ? -107.52 -61.38 50 12 ALA A 30 ? ? -44.85 167.99 51 12 LYS A 37 ? ? -55.44 83.21 52 12 PRO A 39 ? ? -69.77 86.49 53 12 THR A 49 ? ? -35.81 -35.54 54 12 SER A 64 ? ? -50.56 109.87 55 13 SER A 21 ? ? -48.88 178.56 56 13 GLU A 38 ? ? -43.23 151.18 57 13 PRO A 39 ? ? -69.80 90.75 58 14 GLU A 23 ? ? -68.91 -175.92 59 14 ARG A 28 ? ? -38.85 127.45 60 14 LYS A 37 ? ? -63.85 75.15 61 14 THR A 49 ? ? -33.96 -36.51 62 14 SER A 64 ? ? -38.69 121.27 63 15 SER A 5 ? ? -65.41 81.53 64 15 SER A 21 ? ? -57.07 170.94 65 15 ALA A 30 ? ? -50.66 173.31 66 15 PRO A 39 ? ? -69.75 86.41 67 15 SER A 68 ? ? -44.18 164.19 68 16 SER A 21 ? ? -83.92 35.23 69 16 LYS A 37 ? ? -68.10 77.74 70 16 TYR A 47 ? ? -160.03 114.17 71 16 TYR A 54 ? ? -58.80 85.77 72 16 SER A 64 ? ? -35.66 102.86 73 17 ALA A 30 ? ? -43.78 163.45 74 17 SER A 36 ? ? -107.73 72.03 75 17 LYS A 37 ? ? -38.26 97.10 76 17 TRP A 42 ? ? -49.64 164.24 77 18 SER A 2 ? ? 39.13 39.61 78 18 LYS A 19 ? ? -84.44 34.13 79 18 ARG A 20 ? ? 40.00 30.39 80 18 ASP A 22 ? ? 70.87 36.09 81 18 PHE A 26 ? ? -170.61 132.40 82 18 ARG A 28 ? ? -35.93 145.30 83 18 GLU A 38 ? ? -45.76 152.81 84 18 THR A 49 ? ? -35.88 -39.93 85 18 GLN A 52 ? ? 37.26 51.26 86 18 SER A 67 ? ? -38.19 101.57 87 19 ARG A 20 ? ? 37.98 29.40 88 19 SER A 21 ? ? -130.94 -55.30 89 19 ALA A 30 ? ? -45.83 169.02 90 19 LYS A 37 ? ? -58.37 79.57 91 19 PRO A 39 ? ? -69.68 1.37 92 19 SER A 64 ? ? -37.09 123.89 93 19 PRO A 66 ? ? -69.77 93.38 94 20 SER A 2 ? ? -36.53 140.79 95 20 GLU A 23 ? ? -53.92 171.08 96 20 PRO A 39 ? ? -69.77 82.42 97 20 SER A 67 ? ? -164.75 106.71 #