data_2EXD # _entry.id 2EXD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EXD pdb_00002exd 10.2210/pdb2exd/pdb RCSB RCSB035209 ? ? WWPDB D_1000035209 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-12-12 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Experimental preparation' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_nmr_exptl_sample_conditions 5 4 'Structure model' pdbx_nmr_software 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_exptl_sample_conditions.pressure_units' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EXD _pdbx_database_status.recvd_initial_deposition_date 2005-11-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry N _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kuwahara, Y.' 1 'Ohno, A.' 2 'Morii, T.' 3 'Tochio, H.' 4 'Shirakawa, M.' 5 'Hiroaki, H.' 6 # _citation.id primary _citation.title 'The solution structure of the C-terminal domain of NfeD reveals a novel membrane-anchored OB-fold.' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 17 _citation.page_first 1915 _citation.page_last 1924 _citation.year 2008 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18687870 _citation.pdbx_database_id_DOI 10.1110/ps.034736.108 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kuwahara, Y.' 1 ? primary 'Ohno, A.' 2 ? primary 'Morii, T.' 3 ? primary 'Yokoyama, H.' 4 ? primary 'Matsui, I.' 5 ? primary 'Tochio, H.' 6 ? primary 'Shirakawa, M.' 7 ? primary 'Hiroaki, H.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'nfeD short homolog' _entity.formula_weight 9203.565 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Residues 72-143' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code RRETTDIGGGKYTFELKGKVGKVVKIAEDHYLVEVEGDKWIAYSDEKLSLGDRVMVVDVDGLKLKVKRIPPQLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can RRETTDIGGGKYTFELKGKVGKVVKIAEDHYLVEVEGDKWIAYSDEKLSLGDRVMVVDVDGLKLKVKRIPPQLEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 ARG n 1 3 GLU n 1 4 THR n 1 5 THR n 1 6 ASP n 1 7 ILE n 1 8 GLY n 1 9 GLY n 1 10 GLY n 1 11 LYS n 1 12 TYR n 1 13 THR n 1 14 PHE n 1 15 GLU n 1 16 LEU n 1 17 LYS n 1 18 GLY n 1 19 LYS n 1 20 VAL n 1 21 GLY n 1 22 LYS n 1 23 VAL n 1 24 VAL n 1 25 LYS n 1 26 ILE n 1 27 ALA n 1 28 GLU n 1 29 ASP n 1 30 HIS n 1 31 TYR n 1 32 LEU n 1 33 VAL n 1 34 GLU n 1 35 VAL n 1 36 GLU n 1 37 GLY n 1 38 ASP n 1 39 LYS n 1 40 TRP n 1 41 ILE n 1 42 ALA n 1 43 TYR n 1 44 SER n 1 45 ASP n 1 46 GLU n 1 47 LYS n 1 48 LEU n 1 49 SER n 1 50 LEU n 1 51 GLY n 1 52 ASP n 1 53 ARG n 1 54 VAL n 1 55 MET n 1 56 VAL n 1 57 VAL n 1 58 ASP n 1 59 VAL n 1 60 ASP n 1 61 GLY n 1 62 LEU n 1 63 LYS n 1 64 LEU n 1 65 LYS n 1 66 VAL n 1 67 LYS n 1 68 ARG n 1 69 ILE n 1 70 PRO n 1 71 PRO n 1 72 GLN n 1 73 LEU n 1 74 GLU n 1 75 HIS n 1 76 HIS n 1 77 HIS n 1 78 HIS n 1 79 HIS n 1 80 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pyrococcus _entity_src_gen.pdbx_gene_src_gene PH0471 _entity_src_gen.gene_src_species 'Pyrococcus horikoshii' _entity_src_gen.gene_src_strain OT3 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus horikoshii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 70601 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 codonplus(DE3)-RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 72 72 ARG ARG A . n A 1 2 ARG 2 73 73 ARG ARG A . n A 1 3 GLU 3 74 74 GLU GLU A . n A 1 4 THR 4 75 75 THR THR A . n A 1 5 THR 5 76 76 THR THR A . n A 1 6 ASP 6 77 77 ASP ASP A . n A 1 7 ILE 7 78 78 ILE ILE A . n A 1 8 GLY 8 79 79 GLY GLY A . n A 1 9 GLY 9 80 80 GLY GLY A . n A 1 10 GLY 10 81 81 GLY GLY A . n A 1 11 LYS 11 82 82 LYS LYS A . n A 1 12 TYR 12 83 83 TYR TYR A . n A 1 13 THR 13 84 84 THR THR A . n A 1 14 PHE 14 85 85 PHE PHE A . n A 1 15 GLU 15 86 86 GLU GLU A . n A 1 16 LEU 16 87 87 LEU LEU A . n A 1 17 LYS 17 88 88 LYS LYS A . n A 1 18 GLY 18 89 89 GLY GLY A . n A 1 19 LYS 19 90 90 LYS LYS A . n A 1 20 VAL 20 91 91 VAL VAL A . n A 1 21 GLY 21 92 92 GLY GLY A . n A 1 22 LYS 22 93 93 LYS LYS A . n A 1 23 VAL 23 94 94 VAL VAL A . n A 1 24 VAL 24 95 95 VAL VAL A . n A 1 25 LYS 25 96 96 LYS LYS A . n A 1 26 ILE 26 97 97 ILE ILE A . n A 1 27 ALA 27 98 98 ALA ALA A . n A 1 28 GLU 28 99 99 GLU GLU A . n A 1 29 ASP 29 100 100 ASP ASP A . n A 1 30 HIS 30 101 101 HIS HIS A . n A 1 31 TYR 31 102 102 TYR TYR A . n A 1 32 LEU 32 103 103 LEU LEU A . n A 1 33 VAL 33 104 104 VAL VAL A . n A 1 34 GLU 34 105 105 GLU GLU A . n A 1 35 VAL 35 106 106 VAL VAL A . n A 1 36 GLU 36 107 107 GLU GLU A . n A 1 37 GLY 37 108 108 GLY GLY A . n A 1 38 ASP 38 109 109 ASP ASP A . n A 1 39 LYS 39 110 110 LYS LYS A . n A 1 40 TRP 40 111 111 TRP TRP A . n A 1 41 ILE 41 112 112 ILE ILE A . n A 1 42 ALA 42 113 113 ALA ALA A . n A 1 43 TYR 43 114 114 TYR TYR A . n A 1 44 SER 44 115 115 SER SER A . n A 1 45 ASP 45 116 116 ASP ASP A . n A 1 46 GLU 46 117 117 GLU GLU A . n A 1 47 LYS 47 118 118 LYS LYS A . n A 1 48 LEU 48 119 119 LEU LEU A . n A 1 49 SER 49 120 120 SER SER A . n A 1 50 LEU 50 121 121 LEU LEU A . n A 1 51 GLY 51 122 122 GLY GLY A . n A 1 52 ASP 52 123 123 ASP ASP A . n A 1 53 ARG 53 124 124 ARG ARG A . n A 1 54 VAL 54 125 125 VAL VAL A . n A 1 55 MET 55 126 126 MET MET A . n A 1 56 VAL 56 127 127 VAL VAL A . n A 1 57 VAL 57 128 128 VAL VAL A . n A 1 58 ASP 58 129 129 ASP ASP A . n A 1 59 VAL 59 130 130 VAL VAL A . n A 1 60 ASP 60 131 131 ASP ASP A . n A 1 61 GLY 61 132 132 GLY GLY A . n A 1 62 LEU 62 133 133 LEU LEU A . n A 1 63 LYS 63 134 134 LYS LYS A . n A 1 64 LEU 64 135 135 LEU LEU A . n A 1 65 LYS 65 136 136 LYS LYS A . n A 1 66 VAL 66 137 137 VAL VAL A . n A 1 67 LYS 67 138 138 LYS LYS A . n A 1 68 ARG 68 139 139 ARG ARG A . n A 1 69 ILE 69 140 140 ILE ILE A . n A 1 70 PRO 70 141 141 PRO PRO A . n A 1 71 PRO 71 142 142 PRO PRO A . n A 1 72 GLN 72 143 143 GLN GLN A . n A 1 73 LEU 73 144 144 LEU LEU A . n A 1 74 GLU 74 145 145 GLU GLU A . n A 1 75 HIS 75 146 ? ? ? A . n A 1 76 HIS 76 147 ? ? ? A . n A 1 77 HIS 77 148 ? ? ? A . n A 1 78 HIS 78 149 ? ? ? A . n A 1 79 HIS 79 150 ? ? ? A . n A 1 80 HIS 80 151 ? ? ? A . n # _cell.entry_id 2EXD _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2EXD _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 2EXD _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 2EXD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2EXD _struct.title 'The solution structure of the C-terminal domain of a nfeD homolog from Pyrococcus horikoshii' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EXD _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'nfeD, MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code NP_142450 _struct_ref.pdbx_db_accession 14590384 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RRETTDIGGGKYTFELKGKVGKVVKIAEDHYLVEVEGDKWIAYSDEKLSLGDRVMVVDVDGLKLKVKRIPPQ _struct_ref.pdbx_align_begin 72 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EXD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 14590384 _struct_ref_seq.db_align_beg 72 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 143 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 72 _struct_ref_seq.pdbx_auth_seq_align_end 143 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EXD LEU A 73 ? GB 14590384 ? ? 'cloning artifact' 144 1 1 2EXD GLU A 74 ? GB 14590384 ? ? 'cloning artifact' 145 2 1 2EXD HIS A 75 ? GB 14590384 ? ? 'expression tag' 146 3 1 2EXD HIS A 76 ? GB 14590384 ? ? 'expression tag' 147 4 1 2EXD HIS A 77 ? GB 14590384 ? ? 'expression tag' 148 5 1 2EXD HIS A 78 ? GB 14590384 ? ? 'expression tag' 149 6 1 2EXD HIS A 79 ? GB 14590384 ? ? 'expression tag' 150 7 1 2EXD HIS A 80 ? GB 14590384 ? ? 'expression tag' 151 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 38 ? ALA A 42 ? ASP A 109 ALA A 113 A 2 TYR A 31 ? VAL A 35 ? TYR A 102 VAL A 106 A 3 VAL A 20 ? LYS A 25 ? VAL A 91 LYS A 96 A 4 ARG A 53 ? VAL A 59 ? ARG A 124 VAL A 130 A 5 LEU A 64 ? ARG A 68 ? LEU A 135 ARG A 139 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ASP A 38 ? O ASP A 109 N VAL A 35 ? N VAL A 106 A 2 3 O LEU A 32 ? O LEU A 103 N LYS A 25 ? N LYS A 96 A 3 4 N GLY A 21 ? N GLY A 92 O VAL A 54 ? O VAL A 125 A 4 5 N VAL A 57 ? N VAL A 128 O LYS A 65 ? O LYS A 136 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 74 ? ? -33.55 134.42 2 1 THR A 76 ? ? -119.95 51.41 3 1 LEU A 87 ? ? -39.27 -34.56 4 1 LYS A 118 ? ? -39.46 125.62 5 1 ASP A 131 ? ? -104.22 44.51 6 1 LEU A 144 ? ? -34.45 -36.16 7 2 THR A 75 ? ? -61.70 85.38 8 2 THR A 76 ? ? -100.75 -60.38 9 2 LEU A 87 ? ? -34.95 -36.68 10 2 LYS A 118 ? ? -52.68 97.95 11 2 LEU A 119 ? ? -66.96 -177.74 12 2 GLN A 143 ? ? -90.60 39.19 13 3 PHE A 85 ? ? 37.18 41.41 14 3 LYS A 118 ? ? -37.67 105.77 15 3 ASP A 131 ? ? -102.49 48.44 16 3 LEU A 144 ? ? -90.13 41.22 17 4 GLU A 74 ? ? -58.20 171.78 18 4 LYS A 82 ? ? -98.58 38.68 19 4 LEU A 87 ? ? -32.90 -35.26 20 4 LYS A 88 ? ? -41.48 109.97 21 4 LYS A 136 ? ? -55.87 108.82 22 4 LEU A 144 ? ? -85.64 37.38 23 5 GLU A 74 ? ? -33.61 149.74 24 5 THR A 75 ? ? -92.19 55.01 25 5 LYS A 82 ? ? -85.86 39.76 26 5 LEU A 87 ? ? -35.96 -34.18 27 5 LYS A 88 ? ? -50.06 98.50 28 5 VAL A 94 ? ? -65.85 88.87 29 5 LEU A 144 ? ? -85.86 36.68 30 6 LYS A 118 ? ? -53.34 98.61 31 6 LYS A 136 ? ? -53.04 103.14 32 6 PRO A 142 ? ? -69.76 -175.27 33 6 LEU A 144 ? ? -85.70 34.78 34 7 LYS A 82 ? ? -89.99 36.79 35 7 LEU A 87 ? ? -37.22 -35.75 36 7 LYS A 88 ? ? -45.98 109.78 37 7 LYS A 118 ? ? -37.10 113.38 38 7 LEU A 135 ? ? -107.15 79.63 39 7 LYS A 136 ? ? -33.48 126.28 40 7 PRO A 142 ? ? -69.79 -165.86 41 8 TYR A 83 ? ? -131.07 -57.59 42 8 THR A 84 ? ? -132.74 -32.14 43 8 LEU A 87 ? ? -33.80 -38.42 44 8 LYS A 88 ? ? -43.32 106.78 45 8 VAL A 94 ? ? -69.88 93.56 46 8 LYS A 118 ? ? -50.19 101.40 47 8 ASP A 129 ? ? -172.67 149.44 48 9 ASP A 77 ? ? 39.85 37.84 49 9 GLU A 107 ? ? 39.05 41.47 50 9 LEU A 144 ? ? 44.12 25.07 51 10 THR A 75 ? ? -82.80 47.26 52 10 LEU A 87 ? ? -33.93 -39.07 53 10 LYS A 118 ? ? -49.14 97.46 54 10 PRO A 142 ? ? -69.70 -178.57 55 11 LYS A 82 ? ? -101.28 40.43 56 11 LYS A 88 ? ? -43.74 103.34 57 11 ASP A 131 ? ? -105.12 45.49 58 11 LEU A 135 ? ? -160.13 107.74 59 11 GLN A 143 ? ? -91.20 30.51 60 12 GLU A 74 ? ? -42.36 162.68 61 12 LYS A 82 ? ? -88.31 33.22 62 12 LYS A 88 ? ? -58.62 95.92 63 12 LEU A 121 ? ? -39.21 124.03 64 12 LYS A 136 ? ? -59.06 170.47 65 13 LYS A 82 ? ? -84.94 31.81 66 13 THR A 84 ? ? -133.14 -32.11 67 13 LYS A 96 ? ? -174.06 147.94 68 13 LYS A 118 ? ? -49.47 100.59 69 13 LYS A 136 ? ? -38.67 112.19 70 14 THR A 75 ? ? -47.98 107.79 71 14 THR A 76 ? ? -100.84 47.51 72 14 LEU A 87 ? ? -36.75 -37.83 73 14 LYS A 118 ? ? -35.98 133.48 74 14 LEU A 135 ? ? -165.71 107.63 75 15 ASP A 77 ? ? -34.49 133.12 76 15 LYS A 118 ? ? -39.21 101.45 77 15 LEU A 119 ? ? -68.70 -178.52 78 15 VAL A 127 ? ? -66.53 95.91 79 15 VAL A 130 ? ? -167.25 119.20 80 15 PRO A 142 ? ? -69.81 -174.46 81 16 THR A 75 ? ? -170.01 129.11 82 16 LYS A 118 ? ? -40.45 105.97 83 16 ASP A 129 ? ? -175.30 146.08 84 16 LEU A 144 ? ? 43.18 27.52 85 17 LEU A 87 ? ? -38.57 -35.49 86 17 LYS A 118 ? ? -54.73 101.47 87 17 LEU A 135 ? ? -173.63 127.89 88 17 GLN A 143 ? ? -119.51 76.98 89 17 LEU A 144 ? ? 44.92 25.42 90 18 THR A 76 ? ? -170.81 118.79 91 18 LEU A 87 ? ? -32.36 -35.85 92 18 LYS A 118 ? ? -47.98 107.25 93 18 LYS A 136 ? ? -37.11 126.34 94 18 LEU A 144 ? ? -35.59 -31.29 95 19 GLU A 74 ? ? -35.07 130.90 96 19 THR A 75 ? ? -87.44 44.58 97 19 LYS A 82 ? ? -93.20 41.79 98 19 LYS A 88 ? ? -47.46 97.96 99 19 ASP A 116 ? ? -37.17 -33.57 100 19 LYS A 118 ? ? -65.52 99.59 101 19 LEU A 144 ? ? 42.52 26.03 102 20 ARG A 73 ? ? -37.27 -32.67 103 20 THR A 76 ? ? -174.20 115.25 104 20 LYS A 82 ? ? -98.44 39.66 105 20 LEU A 87 ? ? -39.90 -34.94 106 20 LYS A 88 ? ? -41.75 106.56 107 20 ASP A 129 ? ? -175.84 141.90 108 20 LEU A 144 ? ? -78.16 45.88 # _pdbx_nmr_ensemble.entry_id 2EXD _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EXD _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM protein U-15N, 25mM phosphate buffer NA, 300mM NACL, 1mM EDTA, 95% H2O, 5% D2O' '95% H2O/5% D2O' 2 '0.7mM protein U-15N,13C, 25mM phosphate buffer NA, 300mM NACL, 1mM EDTA, 95% H2O, 5% D2O' '95% H2O/5% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 300mM _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 2 3 1 HNHA 2 # _pdbx_nmr_refine.entry_id 2EXD _pdbx_nmr_refine.method 'distance geometry, rigid body restrained molecular dynamics, dihedral angle molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' CYANA 2.0.17 'Peter Guntert' 1 collection XwinNMR 3.5 'Bruker co.' 2 processing NMRPipe 2.3 'F. Delaglio' 3 'data analysis' Sparky 3.106 'Thomas Goddard' 4 refinement CYANA 2.0.17 'Peter Guntert' 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 146 ? A HIS 75 2 1 Y 1 A HIS 147 ? A HIS 76 3 1 Y 1 A HIS 148 ? A HIS 77 4 1 Y 1 A HIS 149 ? A HIS 78 5 1 Y 1 A HIS 150 ? A HIS 79 6 1 Y 1 A HIS 151 ? A HIS 80 7 2 Y 1 A HIS 146 ? A HIS 75 8 2 Y 1 A HIS 147 ? A HIS 76 9 2 Y 1 A HIS 148 ? A HIS 77 10 2 Y 1 A HIS 149 ? A HIS 78 11 2 Y 1 A HIS 150 ? A HIS 79 12 2 Y 1 A HIS 151 ? A HIS 80 13 3 Y 1 A HIS 146 ? A HIS 75 14 3 Y 1 A HIS 147 ? A HIS 76 15 3 Y 1 A HIS 148 ? A HIS 77 16 3 Y 1 A HIS 149 ? A HIS 78 17 3 Y 1 A HIS 150 ? A HIS 79 18 3 Y 1 A HIS 151 ? A HIS 80 19 4 Y 1 A HIS 146 ? A HIS 75 20 4 Y 1 A HIS 147 ? A HIS 76 21 4 Y 1 A HIS 148 ? A HIS 77 22 4 Y 1 A HIS 149 ? A HIS 78 23 4 Y 1 A HIS 150 ? A HIS 79 24 4 Y 1 A HIS 151 ? A HIS 80 25 5 Y 1 A HIS 146 ? A HIS 75 26 5 Y 1 A HIS 147 ? A HIS 76 27 5 Y 1 A HIS 148 ? A HIS 77 28 5 Y 1 A HIS 149 ? A HIS 78 29 5 Y 1 A HIS 150 ? A HIS 79 30 5 Y 1 A HIS 151 ? A HIS 80 31 6 Y 1 A HIS 146 ? A HIS 75 32 6 Y 1 A HIS 147 ? A HIS 76 33 6 Y 1 A HIS 148 ? A HIS 77 34 6 Y 1 A HIS 149 ? A HIS 78 35 6 Y 1 A HIS 150 ? A HIS 79 36 6 Y 1 A HIS 151 ? A HIS 80 37 7 Y 1 A HIS 146 ? A HIS 75 38 7 Y 1 A HIS 147 ? A HIS 76 39 7 Y 1 A HIS 148 ? A HIS 77 40 7 Y 1 A HIS 149 ? A HIS 78 41 7 Y 1 A HIS 150 ? A HIS 79 42 7 Y 1 A HIS 151 ? A HIS 80 43 8 Y 1 A HIS 146 ? A HIS 75 44 8 Y 1 A HIS 147 ? A HIS 76 45 8 Y 1 A HIS 148 ? A HIS 77 46 8 Y 1 A HIS 149 ? A HIS 78 47 8 Y 1 A HIS 150 ? A HIS 79 48 8 Y 1 A HIS 151 ? A HIS 80 49 9 Y 1 A HIS 146 ? A HIS 75 50 9 Y 1 A HIS 147 ? A HIS 76 51 9 Y 1 A HIS 148 ? A HIS 77 52 9 Y 1 A HIS 149 ? A HIS 78 53 9 Y 1 A HIS 150 ? A HIS 79 54 9 Y 1 A HIS 151 ? A HIS 80 55 10 Y 1 A HIS 146 ? A HIS 75 56 10 Y 1 A HIS 147 ? A HIS 76 57 10 Y 1 A HIS 148 ? A HIS 77 58 10 Y 1 A HIS 149 ? A HIS 78 59 10 Y 1 A HIS 150 ? A HIS 79 60 10 Y 1 A HIS 151 ? A HIS 80 61 11 Y 1 A HIS 146 ? A HIS 75 62 11 Y 1 A HIS 147 ? A HIS 76 63 11 Y 1 A HIS 148 ? A HIS 77 64 11 Y 1 A HIS 149 ? A HIS 78 65 11 Y 1 A HIS 150 ? A HIS 79 66 11 Y 1 A HIS 151 ? A HIS 80 67 12 Y 1 A HIS 146 ? A HIS 75 68 12 Y 1 A HIS 147 ? A HIS 76 69 12 Y 1 A HIS 148 ? A HIS 77 70 12 Y 1 A HIS 149 ? A HIS 78 71 12 Y 1 A HIS 150 ? A HIS 79 72 12 Y 1 A HIS 151 ? A HIS 80 73 13 Y 1 A HIS 146 ? A HIS 75 74 13 Y 1 A HIS 147 ? A HIS 76 75 13 Y 1 A HIS 148 ? A HIS 77 76 13 Y 1 A HIS 149 ? A HIS 78 77 13 Y 1 A HIS 150 ? A HIS 79 78 13 Y 1 A HIS 151 ? A HIS 80 79 14 Y 1 A HIS 146 ? A HIS 75 80 14 Y 1 A HIS 147 ? A HIS 76 81 14 Y 1 A HIS 148 ? A HIS 77 82 14 Y 1 A HIS 149 ? A HIS 78 83 14 Y 1 A HIS 150 ? A HIS 79 84 14 Y 1 A HIS 151 ? A HIS 80 85 15 Y 1 A HIS 146 ? A HIS 75 86 15 Y 1 A HIS 147 ? A HIS 76 87 15 Y 1 A HIS 148 ? A HIS 77 88 15 Y 1 A HIS 149 ? A HIS 78 89 15 Y 1 A HIS 150 ? A HIS 79 90 15 Y 1 A HIS 151 ? A HIS 80 91 16 Y 1 A HIS 146 ? A HIS 75 92 16 Y 1 A HIS 147 ? A HIS 76 93 16 Y 1 A HIS 148 ? A HIS 77 94 16 Y 1 A HIS 149 ? A HIS 78 95 16 Y 1 A HIS 150 ? A HIS 79 96 16 Y 1 A HIS 151 ? A HIS 80 97 17 Y 1 A HIS 146 ? A HIS 75 98 17 Y 1 A HIS 147 ? A HIS 76 99 17 Y 1 A HIS 148 ? A HIS 77 100 17 Y 1 A HIS 149 ? A HIS 78 101 17 Y 1 A HIS 150 ? A HIS 79 102 17 Y 1 A HIS 151 ? A HIS 80 103 18 Y 1 A HIS 146 ? A HIS 75 104 18 Y 1 A HIS 147 ? A HIS 76 105 18 Y 1 A HIS 148 ? A HIS 77 106 18 Y 1 A HIS 149 ? A HIS 78 107 18 Y 1 A HIS 150 ? A HIS 79 108 18 Y 1 A HIS 151 ? A HIS 80 109 19 Y 1 A HIS 146 ? A HIS 75 110 19 Y 1 A HIS 147 ? A HIS 76 111 19 Y 1 A HIS 148 ? A HIS 77 112 19 Y 1 A HIS 149 ? A HIS 78 113 19 Y 1 A HIS 150 ? A HIS 79 114 19 Y 1 A HIS 151 ? A HIS 80 115 20 Y 1 A HIS 146 ? A HIS 75 116 20 Y 1 A HIS 147 ? A HIS 76 117 20 Y 1 A HIS 148 ? A HIS 77 118 20 Y 1 A HIS 149 ? A HIS 78 119 20 Y 1 A HIS 150 ? A HIS 79 120 20 Y 1 A HIS 151 ? A HIS 80 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 HIS N N N N 106 HIS CA C N S 107 HIS C C N N 108 HIS O O N N 109 HIS CB C N N 110 HIS CG C Y N 111 HIS ND1 N Y N 112 HIS CD2 C Y N 113 HIS CE1 C Y N 114 HIS NE2 N Y N 115 HIS OXT O N N 116 HIS H H N N 117 HIS H2 H N N 118 HIS HA H N N 119 HIS HB2 H N N 120 HIS HB3 H N N 121 HIS HD1 H N N 122 HIS HD2 H N N 123 HIS HE1 H N N 124 HIS HE2 H N N 125 HIS HXT H N N 126 ILE N N N N 127 ILE CA C N S 128 ILE C C N N 129 ILE O O N N 130 ILE CB C N S 131 ILE CG1 C N N 132 ILE CG2 C N N 133 ILE CD1 C N N 134 ILE OXT O N N 135 ILE H H N N 136 ILE H2 H N N 137 ILE HA H N N 138 ILE HB H N N 139 ILE HG12 H N N 140 ILE HG13 H N N 141 ILE HG21 H N N 142 ILE HG22 H N N 143 ILE HG23 H N N 144 ILE HD11 H N N 145 ILE HD12 H N N 146 ILE HD13 H N N 147 ILE HXT H N N 148 LEU N N N N 149 LEU CA C N S 150 LEU C C N N 151 LEU O O N N 152 LEU CB C N N 153 LEU CG C N N 154 LEU CD1 C N N 155 LEU CD2 C N N 156 LEU OXT O N N 157 LEU H H N N 158 LEU H2 H N N 159 LEU HA H N N 160 LEU HB2 H N N 161 LEU HB3 H N N 162 LEU HG H N N 163 LEU HD11 H N N 164 LEU HD12 H N N 165 LEU HD13 H N N 166 LEU HD21 H N N 167 LEU HD22 H N N 168 LEU HD23 H N N 169 LEU HXT H N N 170 LYS N N N N 171 LYS CA C N S 172 LYS C C N N 173 LYS O O N N 174 LYS CB C N N 175 LYS CG C N N 176 LYS CD C N N 177 LYS CE C N N 178 LYS NZ N N N 179 LYS OXT O N N 180 LYS H H N N 181 LYS H2 H N N 182 LYS HA H N N 183 LYS HB2 H N N 184 LYS HB3 H N N 185 LYS HG2 H N N 186 LYS HG3 H N N 187 LYS HD2 H N N 188 LYS HD3 H N N 189 LYS HE2 H N N 190 LYS HE3 H N N 191 LYS HZ1 H N N 192 LYS HZ2 H N N 193 LYS HZ3 H N N 194 LYS HXT H N N 195 MET N N N N 196 MET CA C N S 197 MET C C N N 198 MET O O N N 199 MET CB C N N 200 MET CG C N N 201 MET SD S N N 202 MET CE C N N 203 MET OXT O N N 204 MET H H N N 205 MET H2 H N N 206 MET HA H N N 207 MET HB2 H N N 208 MET HB3 H N N 209 MET HG2 H N N 210 MET HG3 H N N 211 MET HE1 H N N 212 MET HE2 H N N 213 MET HE3 H N N 214 MET HXT H N N 215 PHE N N N N 216 PHE CA C N S 217 PHE C C N N 218 PHE O O N N 219 PHE CB C N N 220 PHE CG C Y N 221 PHE CD1 C Y N 222 PHE CD2 C Y N 223 PHE CE1 C Y N 224 PHE CE2 C Y N 225 PHE CZ C Y N 226 PHE OXT O N N 227 PHE H H N N 228 PHE H2 H N N 229 PHE HA H N N 230 PHE HB2 H N N 231 PHE HB3 H N N 232 PHE HD1 H N N 233 PHE HD2 H N N 234 PHE HE1 H N N 235 PHE HE2 H N N 236 PHE HZ H N N 237 PHE HXT H N N 238 PRO N N N N 239 PRO CA C N S 240 PRO C C N N 241 PRO O O N N 242 PRO CB C N N 243 PRO CG C N N 244 PRO CD C N N 245 PRO OXT O N N 246 PRO H H N N 247 PRO HA H N N 248 PRO HB2 H N N 249 PRO HB3 H N N 250 PRO HG2 H N N 251 PRO HG3 H N N 252 PRO HD2 H N N 253 PRO HD3 H N N 254 PRO HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 THR N N N N 270 THR CA C N S 271 THR C C N N 272 THR O O N N 273 THR CB C N R 274 THR OG1 O N N 275 THR CG2 C N N 276 THR OXT O N N 277 THR H H N N 278 THR H2 H N N 279 THR HA H N N 280 THR HB H N N 281 THR HG1 H N N 282 THR HG21 H N N 283 THR HG22 H N N 284 THR HG23 H N N 285 THR HXT H N N 286 TRP N N N N 287 TRP CA C N S 288 TRP C C N N 289 TRP O O N N 290 TRP CB C N N 291 TRP CG C Y N 292 TRP CD1 C Y N 293 TRP CD2 C Y N 294 TRP NE1 N Y N 295 TRP CE2 C Y N 296 TRP CE3 C Y N 297 TRP CZ2 C Y N 298 TRP CZ3 C Y N 299 TRP CH2 C Y N 300 TRP OXT O N N 301 TRP H H N N 302 TRP H2 H N N 303 TRP HA H N N 304 TRP HB2 H N N 305 TRP HB3 H N N 306 TRP HD1 H N N 307 TRP HE1 H N N 308 TRP HE3 H N N 309 TRP HZ2 H N N 310 TRP HZ3 H N N 311 TRP HH2 H N N 312 TRP HXT H N N 313 TYR N N N N 314 TYR CA C N S 315 TYR C C N N 316 TYR O O N N 317 TYR CB C N N 318 TYR CG C Y N 319 TYR CD1 C Y N 320 TYR CD2 C Y N 321 TYR CE1 C Y N 322 TYR CE2 C Y N 323 TYR CZ C Y N 324 TYR OH O N N 325 TYR OXT O N N 326 TYR H H N N 327 TYR H2 H N N 328 TYR HA H N N 329 TYR HB2 H N N 330 TYR HB3 H N N 331 TYR HD1 H N N 332 TYR HD2 H N N 333 TYR HE1 H N N 334 TYR HE2 H N N 335 TYR HH H N N 336 TYR HXT H N N 337 VAL N N N N 338 VAL CA C N S 339 VAL C C N N 340 VAL O O N N 341 VAL CB C N N 342 VAL CG1 C N N 343 VAL CG2 C N N 344 VAL OXT O N N 345 VAL H H N N 346 VAL H2 H N N 347 VAL HA H N N 348 VAL HB H N N 349 VAL HG11 H N N 350 VAL HG12 H N N 351 VAL HG13 H N N 352 VAL HG21 H N N 353 VAL HG22 H N N 354 VAL HG23 H N N 355 VAL HXT H N N 356 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 HIS N CA sing N N 100 HIS N H sing N N 101 HIS N H2 sing N N 102 HIS CA C sing N N 103 HIS CA CB sing N N 104 HIS CA HA sing N N 105 HIS C O doub N N 106 HIS C OXT sing N N 107 HIS CB CG sing N N 108 HIS CB HB2 sing N N 109 HIS CB HB3 sing N N 110 HIS CG ND1 sing Y N 111 HIS CG CD2 doub Y N 112 HIS ND1 CE1 doub Y N 113 HIS ND1 HD1 sing N N 114 HIS CD2 NE2 sing Y N 115 HIS CD2 HD2 sing N N 116 HIS CE1 NE2 sing Y N 117 HIS CE1 HE1 sing N N 118 HIS NE2 HE2 sing N N 119 HIS OXT HXT sing N N 120 ILE N CA sing N N 121 ILE N H sing N N 122 ILE N H2 sing N N 123 ILE CA C sing N N 124 ILE CA CB sing N N 125 ILE CA HA sing N N 126 ILE C O doub N N 127 ILE C OXT sing N N 128 ILE CB CG1 sing N N 129 ILE CB CG2 sing N N 130 ILE CB HB sing N N 131 ILE CG1 CD1 sing N N 132 ILE CG1 HG12 sing N N 133 ILE CG1 HG13 sing N N 134 ILE CG2 HG21 sing N N 135 ILE CG2 HG22 sing N N 136 ILE CG2 HG23 sing N N 137 ILE CD1 HD11 sing N N 138 ILE CD1 HD12 sing N N 139 ILE CD1 HD13 sing N N 140 ILE OXT HXT sing N N 141 LEU N CA sing N N 142 LEU N H sing N N 143 LEU N H2 sing N N 144 LEU CA C sing N N 145 LEU CA CB sing N N 146 LEU CA HA sing N N 147 LEU C O doub N N 148 LEU C OXT sing N N 149 LEU CB CG sing N N 150 LEU CB HB2 sing N N 151 LEU CB HB3 sing N N 152 LEU CG CD1 sing N N 153 LEU CG CD2 sing N N 154 LEU CG HG sing N N 155 LEU CD1 HD11 sing N N 156 LEU CD1 HD12 sing N N 157 LEU CD1 HD13 sing N N 158 LEU CD2 HD21 sing N N 159 LEU CD2 HD22 sing N N 160 LEU CD2 HD23 sing N N 161 LEU OXT HXT sing N N 162 LYS N CA sing N N 163 LYS N H sing N N 164 LYS N H2 sing N N 165 LYS CA C sing N N 166 LYS CA CB sing N N 167 LYS CA HA sing N N 168 LYS C O doub N N 169 LYS C OXT sing N N 170 LYS CB CG sing N N 171 LYS CB HB2 sing N N 172 LYS CB HB3 sing N N 173 LYS CG CD sing N N 174 LYS CG HG2 sing N N 175 LYS CG HG3 sing N N 176 LYS CD CE sing N N 177 LYS CD HD2 sing N N 178 LYS CD HD3 sing N N 179 LYS CE NZ sing N N 180 LYS CE HE2 sing N N 181 LYS CE HE3 sing N N 182 LYS NZ HZ1 sing N N 183 LYS NZ HZ2 sing N N 184 LYS NZ HZ3 sing N N 185 LYS OXT HXT sing N N 186 MET N CA sing N N 187 MET N H sing N N 188 MET N H2 sing N N 189 MET CA C sing N N 190 MET CA CB sing N N 191 MET CA HA sing N N 192 MET C O doub N N 193 MET C OXT sing N N 194 MET CB CG sing N N 195 MET CB HB2 sing N N 196 MET CB HB3 sing N N 197 MET CG SD sing N N 198 MET CG HG2 sing N N 199 MET CG HG3 sing N N 200 MET SD CE sing N N 201 MET CE HE1 sing N N 202 MET CE HE2 sing N N 203 MET CE HE3 sing N N 204 MET OXT HXT sing N N 205 PHE N CA sing N N 206 PHE N H sing N N 207 PHE N H2 sing N N 208 PHE CA C sing N N 209 PHE CA CB sing N N 210 PHE CA HA sing N N 211 PHE C O doub N N 212 PHE C OXT sing N N 213 PHE CB CG sing N N 214 PHE CB HB2 sing N N 215 PHE CB HB3 sing N N 216 PHE CG CD1 doub Y N 217 PHE CG CD2 sing Y N 218 PHE CD1 CE1 sing Y N 219 PHE CD1 HD1 sing N N 220 PHE CD2 CE2 doub Y N 221 PHE CD2 HD2 sing N N 222 PHE CE1 CZ doub Y N 223 PHE CE1 HE1 sing N N 224 PHE CE2 CZ sing Y N 225 PHE CE2 HE2 sing N N 226 PHE CZ HZ sing N N 227 PHE OXT HXT sing N N 228 PRO N CA sing N N 229 PRO N CD sing N N 230 PRO N H sing N N 231 PRO CA C sing N N 232 PRO CA CB sing N N 233 PRO CA HA sing N N 234 PRO C O doub N N 235 PRO C OXT sing N N 236 PRO CB CG sing N N 237 PRO CB HB2 sing N N 238 PRO CB HB3 sing N N 239 PRO CG CD sing N N 240 PRO CG HG2 sing N N 241 PRO CG HG3 sing N N 242 PRO CD HD2 sing N N 243 PRO CD HD3 sing N N 244 PRO OXT HXT sing N N 245 SER N CA sing N N 246 SER N H sing N N 247 SER N H2 sing N N 248 SER CA C sing N N 249 SER CA CB sing N N 250 SER CA HA sing N N 251 SER C O doub N N 252 SER C OXT sing N N 253 SER CB OG sing N N 254 SER CB HB2 sing N N 255 SER CB HB3 sing N N 256 SER OG HG sing N N 257 SER OXT HXT sing N N 258 THR N CA sing N N 259 THR N H sing N N 260 THR N H2 sing N N 261 THR CA C sing N N 262 THR CA CB sing N N 263 THR CA HA sing N N 264 THR C O doub N N 265 THR C OXT sing N N 266 THR CB OG1 sing N N 267 THR CB CG2 sing N N 268 THR CB HB sing N N 269 THR OG1 HG1 sing N N 270 THR CG2 HG21 sing N N 271 THR CG2 HG22 sing N N 272 THR CG2 HG23 sing N N 273 THR OXT HXT sing N N 274 TRP N CA sing N N 275 TRP N H sing N N 276 TRP N H2 sing N N 277 TRP CA C sing N N 278 TRP CA CB sing N N 279 TRP CA HA sing N N 280 TRP C O doub N N 281 TRP C OXT sing N N 282 TRP CB CG sing N N 283 TRP CB HB2 sing N N 284 TRP CB HB3 sing N N 285 TRP CG CD1 doub Y N 286 TRP CG CD2 sing Y N 287 TRP CD1 NE1 sing Y N 288 TRP CD1 HD1 sing N N 289 TRP CD2 CE2 doub Y N 290 TRP CD2 CE3 sing Y N 291 TRP NE1 CE2 sing Y N 292 TRP NE1 HE1 sing N N 293 TRP CE2 CZ2 sing Y N 294 TRP CE3 CZ3 doub Y N 295 TRP CE3 HE3 sing N N 296 TRP CZ2 CH2 doub Y N 297 TRP CZ2 HZ2 sing N N 298 TRP CZ3 CH2 sing Y N 299 TRP CZ3 HZ3 sing N N 300 TRP CH2 HH2 sing N N 301 TRP OXT HXT sing N N 302 TYR N CA sing N N 303 TYR N H sing N N 304 TYR N H2 sing N N 305 TYR CA C sing N N 306 TYR CA CB sing N N 307 TYR CA HA sing N N 308 TYR C O doub N N 309 TYR C OXT sing N N 310 TYR CB CG sing N N 311 TYR CB HB2 sing N N 312 TYR CB HB3 sing N N 313 TYR CG CD1 doub Y N 314 TYR CG CD2 sing Y N 315 TYR CD1 CE1 sing Y N 316 TYR CD1 HD1 sing N N 317 TYR CD2 CE2 doub Y N 318 TYR CD2 HD2 sing N N 319 TYR CE1 CZ doub Y N 320 TYR CE1 HE1 sing N N 321 TYR CE2 CZ sing Y N 322 TYR CE2 HE2 sing N N 323 TYR CZ OH sing N N 324 TYR OH HH sing N N 325 TYR OXT HXT sing N N 326 VAL N CA sing N N 327 VAL N H sing N N 328 VAL N H2 sing N N 329 VAL CA C sing N N 330 VAL CA CB sing N N 331 VAL CA HA sing N N 332 VAL C O doub N N 333 VAL C OXT sing N N 334 VAL CB CG1 sing N N 335 VAL CB CG2 sing N N 336 VAL CB HB sing N N 337 VAL CG1 HG11 sing N N 338 VAL CG1 HG12 sing N N 339 VAL CG1 HG13 sing N N 340 VAL CG2 HG21 sing N N 341 VAL CG2 HG22 sing N N 342 VAL CG2 HG23 sing N N 343 VAL OXT HXT sing N N 344 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DRX Bruker 800 ? 2 INOVA Varian 900 ? # _atom_sites.entry_id 2EXD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_