data_2F09 # _entry.id 2F09 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2F09 pdb_00002f09 10.2210/pdb2f09/pdb RCSB RCSB035291 ? ? WWPDB D_1000035291 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2F09 _pdbx_database_status.recvd_initial_deposition_date 2005-11-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Shaw, G.S.' 1 'Revington, M.J.' 2 'Ontario Centre for Structural Proteomics (OCSP)' 3 # _citation.id primary _citation.title 'The solution structure of the Escherichia coli gene product ydhA.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shaw, G.S.' 1 ? primary 'Revington, M.J.' 2 ? # _cell.entry_id 2F09 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2F09 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical protein ydhA' _entity.formula_weight 11736.067 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMQTDTLEYQCDEKPLTVKLNNPRQEVSFVYDNQLLHLKQGISASGARYTDGIYVFWSKGD EATVYKRDRIVLNNCQLQNPQR ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMQTDTLEYQCDEKPLTVKLNNPRQEVSFVYDNQLLHLKQGISASGARYTDGIYVFWSKGD EATVYKRDRIVLNNCQLQNPQR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 GLN n 1 23 THR n 1 24 ASP n 1 25 THR n 1 26 LEU n 1 27 GLU n 1 28 TYR n 1 29 GLN n 1 30 CYS n 1 31 ASP n 1 32 GLU n 1 33 LYS n 1 34 PRO n 1 35 LEU n 1 36 THR n 1 37 VAL n 1 38 LYS n 1 39 LEU n 1 40 ASN n 1 41 ASN n 1 42 PRO n 1 43 ARG n 1 44 GLN n 1 45 GLU n 1 46 VAL n 1 47 SER n 1 48 PHE n 1 49 VAL n 1 50 TYR n 1 51 ASP n 1 52 ASN n 1 53 GLN n 1 54 LEU n 1 55 LEU n 1 56 HIS n 1 57 LEU n 1 58 LYS n 1 59 GLN n 1 60 GLY n 1 61 ILE n 1 62 SER n 1 63 ALA n 1 64 SER n 1 65 GLY n 1 66 ALA n 1 67 ARG n 1 68 TYR n 1 69 THR n 1 70 ASP n 1 71 GLY n 1 72 ILE n 1 73 TYR n 1 74 VAL n 1 75 PHE n 1 76 TRP n 1 77 SER n 1 78 LYS n 1 79 GLY n 1 80 ASP n 1 81 GLU n 1 82 ALA n 1 83 THR n 1 84 VAL n 1 85 TYR n 1 86 LYS n 1 87 ARG n 1 88 ASP n 1 89 ARG n 1 90 ILE n 1 91 VAL n 1 92 LEU n 1 93 ASN n 1 94 ASN n 1 95 CYS n 1 96 GLN n 1 97 LEU n 1 98 GLN n 1 99 ASN n 1 100 PRO n 1 101 GLN n 1 102 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ydhA _entity_src_gen.gene_src_species 'Escherichia coli' _entity_src_gen.gene_src_strain K-12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli K12' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pEt15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YDHA_ECOLI _struct_ref.pdbx_db_accession P28224 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MQTDTLEYQCDEKPLTVKLNNPRQEVSFVYDNQLLHLKQGISASGARYTDGIYVFWSKGDEATVYKRDRIVLNNCQLQNP QR ; _struct_ref.pdbx_align_begin 28 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2F09 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 102 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P28224 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 109 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 82 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2F09 MET A 1 ? UNP P28224 ? ? 'cloning artifact' -19 1 1 2F09 GLY A 2 ? UNP P28224 ? ? 'cloning artifact' -18 2 1 2F09 SER A 3 ? UNP P28224 ? ? 'cloning artifact' -17 3 1 2F09 SER A 4 ? UNP P28224 ? ? 'cloning artifact' -16 4 1 2F09 HIS A 5 ? UNP P28224 ? ? 'expression tag' -15 5 1 2F09 HIS A 6 ? UNP P28224 ? ? 'expression tag' -14 6 1 2F09 HIS A 7 ? UNP P28224 ? ? 'expression tag' -13 7 1 2F09 HIS A 8 ? UNP P28224 ? ? 'expression tag' -12 8 1 2F09 HIS A 9 ? UNP P28224 ? ? 'expression tag' -11 9 1 2F09 HIS A 10 ? UNP P28224 ? ? 'expression tag' -10 10 1 2F09 SER A 11 ? UNP P28224 ? ? 'cloning artifact' -9 11 1 2F09 SER A 12 ? UNP P28224 ? ? 'cloning artifact' -8 12 1 2F09 GLY A 13 ? UNP P28224 ? ? 'cloning artifact' -7 13 1 2F09 LEU A 14 ? UNP P28224 ? ? 'cloning artifact' -6 14 1 2F09 VAL A 15 ? UNP P28224 ? ? 'cloning artifact' -5 15 1 2F09 PRO A 16 ? UNP P28224 ? ? 'cloning artifact' -4 16 1 2F09 ARG A 17 ? UNP P28224 ? ? 'cloning artifact' -3 17 1 2F09 GLY A 18 ? UNP P28224 ? ? 'cloning artifact' -2 18 1 2F09 SER A 19 ? UNP P28224 ? ? 'cloning artifact' -1 19 1 2F09 HIS A 20 ? UNP P28224 ? ? 'cloning artifact' 0 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '410 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;0.5 mM ydha U-15N,U-13C, 10mM sodium phosphate, 400 mM NaCl, 10 mM dithiothreitol, 0.01% sodium azide, 1mM benzamidine, pH6.5, 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2F09 _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2F09 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy' # _pdbx_nmr_ensemble.entry_id 2F09 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2F09 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1B 'Varian Inc.' 1 processing NMRPipe 2.3 'Frank Delaglio Stephan Grzesiek, Guang Zhu, Geerten W. Vuister, John Pfeifer, and Ad Bax' 2 'data analysis' NMRView 5.2.2 'B.A. Johnson' 3 refinement CYANA 2.032.3 'Guntert, P., Mumenthaler, C. and Wuthrich, K.' 4 refinement CNS 1.1 ;A.T.Brunger, P.D.Adams, G.M.Clore, W.L.Delano, P.Gros,R.W.Grosse-Kunstleve, J.-S.Jiang, J.Kuszewski, M.Nilges,N.S.Pannu, R.J.Read, L.M.Rice, T.Simonson, G.L.Warren ; 5 # _exptl.entry_id 2F09 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2F09 _struct.title 'Solution Structure of the gene product of E. coli gene ydhA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2F09 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text '8 strand beta-barrel, Structural Genomics, Ontario Centre for Structural Proteomics, OCSP, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 30 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 95 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 10 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 75 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.041 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 37 ? LEU A 39 ? VAL A 17 LEU A 19 A 2 GLU A 45 ? VAL A 49 ? GLU A 25 VAL A 29 A 3 LEU A 54 ? GLN A 59 ? LEU A 34 GLN A 39 A 4 ALA A 66 ? THR A 69 ? ALA A 46 THR A 49 A 5 VAL A 74 ? SER A 77 ? VAL A 54 SER A 57 A 6 ALA A 82 ? TYR A 85 ? ALA A 62 TYR A 65 A 7 ILE A 90 ? LEU A 92 ? ILE A 70 LEU A 72 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 38 ? N LYS A 18 O SER A 47 ? O SER A 27 A 2 3 N PHE A 48 ? N PHE A 28 O LEU A 55 ? O LEU A 35 A 3 4 N LYS A 58 ? N LYS A 38 O THR A 69 ? O THR A 49 A 4 5 N ALA A 66 ? N ALA A 46 O SER A 77 ? O SER A 57 A 5 6 N TRP A 76 ? N TRP A 56 O THR A 83 ? O THR A 63 A 6 7 N VAL A 84 ? N VAL A 64 O LEU A 92 ? O LEU A 72 # _database_PDB_matrix.entry_id 2F09 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2F09 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 GLN 22 2 2 GLN GLN A . n A 1 23 THR 23 3 3 THR THR A . n A 1 24 ASP 24 4 4 ASP ASP A . n A 1 25 THR 25 5 5 THR THR A . n A 1 26 LEU 26 6 6 LEU LEU A . n A 1 27 GLU 27 7 7 GLU GLU A . n A 1 28 TYR 28 8 8 TYR TYR A . n A 1 29 GLN 29 9 9 GLN GLN A . n A 1 30 CYS 30 10 10 CYS CYS A . n A 1 31 ASP 31 11 11 ASP ASP A . n A 1 32 GLU 32 12 12 GLU GLU A . n A 1 33 LYS 33 13 13 LYS LYS A . n A 1 34 PRO 34 14 14 PRO PRO A . n A 1 35 LEU 35 15 15 LEU LEU A . n A 1 36 THR 36 16 16 THR THR A . n A 1 37 VAL 37 17 17 VAL VAL A . n A 1 38 LYS 38 18 18 LYS LYS A . n A 1 39 LEU 39 19 19 LEU LEU A . n A 1 40 ASN 40 20 20 ASN ASN A . n A 1 41 ASN 41 21 21 ASN ASN A . n A 1 42 PRO 42 22 22 PRO PRO A . n A 1 43 ARG 43 23 23 ARG ARG A . n A 1 44 GLN 44 24 24 GLN GLN A . n A 1 45 GLU 45 25 25 GLU GLU A . n A 1 46 VAL 46 26 26 VAL VAL A . n A 1 47 SER 47 27 27 SER SER A . n A 1 48 PHE 48 28 28 PHE PHE A . n A 1 49 VAL 49 29 29 VAL VAL A . n A 1 50 TYR 50 30 30 TYR TYR A . n A 1 51 ASP 51 31 31 ASP ASP A . n A 1 52 ASN 52 32 32 ASN ASN A . n A 1 53 GLN 53 33 33 GLN GLN A . n A 1 54 LEU 54 34 34 LEU LEU A . n A 1 55 LEU 55 35 35 LEU LEU A . n A 1 56 HIS 56 36 36 HIS HIS A . n A 1 57 LEU 57 37 37 LEU LEU A . n A 1 58 LYS 58 38 38 LYS LYS A . n A 1 59 GLN 59 39 39 GLN GLN A . n A 1 60 GLY 60 40 40 GLY GLY A . n A 1 61 ILE 61 41 41 ILE ILE A . n A 1 62 SER 62 42 42 SER SER A . n A 1 63 ALA 63 43 43 ALA ALA A . n A 1 64 SER 64 44 44 SER SER A . n A 1 65 GLY 65 45 45 GLY GLY A . n A 1 66 ALA 66 46 46 ALA ALA A . n A 1 67 ARG 67 47 47 ARG ARG A . n A 1 68 TYR 68 48 48 TYR TYR A . n A 1 69 THR 69 49 49 THR THR A . n A 1 70 ASP 70 50 50 ASP ASP A . n A 1 71 GLY 71 51 51 GLY GLY A . n A 1 72 ILE 72 52 52 ILE ILE A . n A 1 73 TYR 73 53 53 TYR TYR A . n A 1 74 VAL 74 54 54 VAL VAL A . n A 1 75 PHE 75 55 55 PHE PHE A . n A 1 76 TRP 76 56 56 TRP TRP A . n A 1 77 SER 77 57 57 SER SER A . n A 1 78 LYS 78 58 58 LYS LYS A . n A 1 79 GLY 79 59 59 GLY GLY A . n A 1 80 ASP 80 60 60 ASP ASP A . n A 1 81 GLU 81 61 61 GLU GLU A . n A 1 82 ALA 82 62 62 ALA ALA A . n A 1 83 THR 83 63 63 THR THR A . n A 1 84 VAL 84 64 64 VAL VAL A . n A 1 85 TYR 85 65 65 TYR TYR A . n A 1 86 LYS 86 66 66 LYS LYS A . n A 1 87 ARG 87 67 67 ARG ARG A . n A 1 88 ASP 88 68 68 ASP ASP A . n A 1 89 ARG 89 69 69 ARG ARG A . n A 1 90 ILE 90 70 70 ILE ILE A . n A 1 91 VAL 91 71 71 VAL VAL A . n A 1 92 LEU 92 72 72 LEU LEU A . n A 1 93 ASN 93 73 73 ASN ASN A . n A 1 94 ASN 94 74 74 ASN ASN A . n A 1 95 CYS 95 75 75 CYS CYS A . n A 1 96 GLN 96 76 76 GLN GLN A . n A 1 97 LEU 97 77 77 LEU LEU A . n A 1 98 GLN 98 78 78 GLN GLN A . n A 1 99 ASN 99 79 79 ASN ASN A . n A 1 100 PRO 100 80 80 PRO PRO A . n A 1 101 GLN 101 81 81 GLN GLN A . n A 1 102 ARG 102 82 82 ARG ARG A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Ontario Centre for Structural Proteomics' _pdbx_SG_project.initial_of_center OCSP # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-12-13 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 HZ1 A LYS 13 ? ? OD1 A ASP 31 ? ? 1.58 2 5 HZ3 A LYS 13 ? ? OD1 A ASP 31 ? ? 1.57 3 13 OE2 A GLU 12 ? ? H A ASN 73 ? ? 1.57 4 16 HZ1 A LYS 58 ? ? OE2 A GLU 61 ? ? 1.60 5 20 HZ3 A LYS 13 ? ? OD1 A ASP 31 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 6 ? ? -78.32 -154.78 2 1 TYR A 8 ? ? 50.82 7.82 3 1 GLN A 9 ? ? -156.45 82.59 4 1 LEU A 15 ? ? -101.92 69.24 5 1 ASP A 31 ? ? -173.90 -58.19 6 1 ASN A 32 ? ? -145.74 15.20 7 1 ALA A 43 ? ? -139.64 -44.06 8 1 ASP A 68 ? ? 167.41 -31.99 9 1 ASN A 74 ? ? -162.03 87.62 10 1 ASN A 79 ? ? 171.39 146.24 11 1 PRO A 80 ? ? -78.76 -149.90 12 2 LEU A 6 ? ? -76.51 -164.48 13 2 LYS A 18 ? ? -108.48 75.47 14 2 GLN A 24 ? ? -40.30 56.74 15 2 ASP A 31 ? ? -173.45 -50.86 16 2 ALA A 43 ? ? -78.82 -77.93 17 2 ASP A 50 ? ? -141.39 -75.36 18 2 ASN A 73 ? ? -146.18 17.49 19 2 ASN A 74 ? ? -153.43 81.35 20 2 GLN A 81 ? ? -111.17 53.94 21 3 LEU A 6 ? ? -85.48 -146.67 22 3 TYR A 8 ? ? 57.27 -6.68 23 3 LEU A 15 ? ? -107.12 78.65 24 3 ASP A 31 ? ? -167.24 -68.13 25 3 ALA A 43 ? ? -118.98 -90.56 26 3 ASN A 79 ? ? -177.73 125.33 27 4 LEU A 6 ? ? -81.49 -155.37 28 4 TYR A 8 ? ? 48.88 16.79 29 4 ASP A 31 ? ? -172.83 -67.28 30 4 SER A 42 ? ? -67.75 88.95 31 4 SER A 44 ? ? -151.31 27.95 32 4 LYS A 58 ? ? -86.57 -72.06 33 4 ARG A 69 ? ? -170.10 110.26 34 4 ASN A 74 ? ? -169.15 93.23 35 5 LEU A 6 ? ? -82.64 -148.08 36 5 TYR A 8 ? ? 50.94 -6.26 37 5 LEU A 15 ? ? -112.21 79.52 38 5 ASP A 31 ? ? -175.52 -53.42 39 5 ALA A 43 ? ? -162.86 -48.85 40 5 ILE A 52 ? ? -126.20 -61.38 41 5 ARG A 69 ? ? -176.67 128.26 42 5 ASN A 79 ? ? -173.51 117.24 43 6 LYS A 18 ? ? -102.11 69.40 44 6 ARG A 23 ? ? -165.59 86.38 45 6 GLN A 24 ? ? -47.16 29.63 46 6 ASP A 31 ? ? -176.06 -54.83 47 6 ASN A 32 ? ? -144.15 27.43 48 6 ALA A 43 ? ? 170.72 -76.17 49 6 ASP A 50 ? ? -101.77 -75.91 50 6 ILE A 52 ? ? -127.52 -68.03 51 6 ASN A 79 ? ? 179.60 118.02 52 7 TYR A 8 ? ? 50.42 7.63 53 7 GLN A 9 ? ? -146.02 42.73 54 7 ASP A 31 ? ? -154.71 -68.13 55 7 ASN A 32 ? ? -147.64 10.72 56 7 LEU A 72 ? ? 176.26 120.63 57 7 ASN A 74 ? ? -162.04 88.90 58 7 ASN A 79 ? ? 175.25 140.30 59 8 LEU A 6 ? ? -70.15 -163.35 60 8 TYR A 8 ? ? 54.05 16.49 61 8 LEU A 15 ? ? -108.60 61.63 62 8 TYR A 30 ? ? -97.65 38.88 63 8 ASP A 31 ? ? 70.60 102.86 64 8 ALA A 43 ? ? 75.35 -44.85 65 8 ASP A 50 ? ? -157.63 79.92 66 8 GLN A 81 ? ? -105.30 79.21 67 9 LEU A 6 ? ? -75.25 -163.33 68 9 LEU A 15 ? ? -109.63 75.53 69 9 ASP A 31 ? ? -163.14 -59.83 70 9 ASN A 32 ? ? -147.07 40.53 71 9 ILE A 41 ? ? -92.27 34.41 72 9 ASP A 50 ? ? -150.96 65.12 73 9 LYS A 58 ? ? -113.54 -149.10 74 9 LEU A 72 ? ? -131.22 -93.96 75 9 ASN A 74 ? ? -158.88 80.62 76 9 ASN A 79 ? ? 170.41 137.51 77 10 LEU A 6 ? ? -61.45 -171.03 78 10 TYR A 8 ? ? 49.73 20.83 79 10 LEU A 15 ? ? -105.27 76.35 80 10 ARG A 23 ? ? 61.13 62.47 81 10 ASP A 31 ? ? -170.18 -58.67 82 10 SER A 44 ? ? -50.86 95.36 83 10 ALA A 46 ? ? -176.02 130.61 84 10 ILE A 52 ? ? -90.48 -60.55 85 10 ARG A 69 ? ? -162.92 107.10 86 10 ASN A 74 ? ? -158.47 83.28 87 10 ASN A 79 ? ? -164.35 101.94 88 10 GLN A 81 ? ? -115.65 77.60 89 11 ASP A 4 ? ? -37.78 117.53 90 11 LEU A 6 ? ? -70.45 -162.14 91 11 TYR A 8 ? ? 51.72 16.09 92 11 ARG A 23 ? ? 63.44 67.60 93 11 ASP A 31 ? ? -166.94 -64.52 94 11 ASN A 32 ? ? -148.12 33.29 95 11 ALA A 43 ? ? -164.44 -54.64 96 11 ARG A 69 ? ? -168.06 107.72 97 11 ASN A 74 ? ? -171.58 88.37 98 11 ASN A 79 ? ? -172.42 111.92 99 12 LEU A 6 ? ? -75.36 -160.35 100 12 GLN A 9 ? ? -161.23 116.03 101 12 ASP A 31 ? ? -165.74 -66.99 102 12 ASN A 32 ? ? -142.92 20.58 103 12 ALA A 43 ? ? 174.36 -46.41 104 12 ASP A 50 ? ? -125.72 -77.16 105 12 ARG A 69 ? ? -165.28 115.61 106 12 ASN A 79 ? ? 178.73 135.56 107 13 GLN A 2 ? ? -147.01 -145.61 108 13 TYR A 8 ? ? 48.79 16.36 109 13 ASP A 31 ? ? -157.25 -45.31 110 13 ASN A 32 ? ? -141.19 15.80 111 13 SER A 44 ? ? 58.47 84.23 112 13 ASN A 79 ? ? -164.68 104.21 113 14 LEU A 6 ? ? -78.23 -158.86 114 14 TYR A 8 ? ? 51.28 13.60 115 14 ASP A 31 ? ? -137.23 -49.92 116 14 ASN A 32 ? ? -156.14 26.84 117 14 ALA A 43 ? ? -177.81 -36.17 118 14 LEU A 72 ? ? 176.64 132.82 119 14 ASN A 74 ? ? -159.19 80.30 120 15 LEU A 6 ? ? -72.85 -157.29 121 15 TYR A 8 ? ? 51.42 15.48 122 15 LEU A 15 ? ? -101.02 70.86 123 15 ASP A 31 ? ? -165.65 -55.46 124 15 ASN A 32 ? ? -148.52 28.62 125 15 SER A 42 ? ? -106.24 -165.50 126 15 ALA A 43 ? ? -163.91 -40.97 127 15 ASP A 50 ? ? -153.45 67.66 128 15 ASN A 73 ? ? -145.47 19.03 129 15 ASN A 79 ? ? -172.97 125.98 130 16 LEU A 6 ? ? -78.69 -152.99 131 16 TYR A 8 ? ? 47.69 18.45 132 16 GLN A 9 ? ? -147.56 43.77 133 16 ASP A 31 ? ? 173.27 -58.51 134 16 ALA A 43 ? ? -158.99 -86.65 135 16 ARG A 69 ? ? -168.55 111.45 136 16 ASN A 73 ? ? -141.06 23.21 137 16 ASN A 74 ? ? -153.28 87.08 138 16 ASN A 79 ? ? -170.54 119.76 139 17 ASP A 31 ? ? -166.58 -65.60 140 17 ALA A 46 ? ? -162.48 112.98 141 17 LYS A 58 ? ? -119.27 71.25 142 17 ARG A 69 ? ? 164.92 134.34 143 17 LEU A 72 ? ? -161.18 114.98 144 17 ASN A 74 ? ? -159.19 88.49 145 17 ASN A 79 ? ? -169.12 111.43 146 18 LEU A 6 ? ? -73.80 -165.94 147 18 ASP A 31 ? ? -160.79 -63.53 148 18 ASN A 32 ? ? -147.64 38.08 149 18 ASN A 79 ? ? -170.43 117.84 150 19 LEU A 6 ? ? -78.82 -161.44 151 19 TYR A 8 ? ? 49.85 23.00 152 19 ASP A 31 ? ? -163.89 -52.86 153 19 ALA A 43 ? ? -167.98 -165.34 154 19 SER A 44 ? ? -68.01 94.83 155 19 LEU A 72 ? ? -173.81 128.47 156 19 ASN A 79 ? ? -177.24 112.76 157 20 LEU A 6 ? ? -110.70 -146.18 158 20 TYR A 8 ? ? 51.94 -1.07 159 20 LEU A 15 ? ? -104.55 71.63 160 20 LYS A 18 ? ? -108.15 77.07 161 20 ASP A 31 ? ? 71.98 -58.04 162 20 ASN A 32 ? ? -141.20 27.07 163 20 ALA A 43 ? ? -171.28 -154.06 164 20 SER A 44 ? ? -62.38 95.51 165 20 ASP A 68 ? ? 172.97 -35.18 166 20 ARG A 69 ? ? -170.25 119.59 167 20 ASN A 79 ? ? -165.29 113.36 168 20 PRO A 80 ? ? -65.63 -98.77 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 4 ARG A 47 ? ? 0.114 'SIDE CHAIN' 2 9 ARG A 69 ? ? 0.083 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 2 Y 1 A MET -19 ? A MET 1 22 2 Y 1 A GLY -18 ? A GLY 2 23 2 Y 1 A SER -17 ? A SER 3 24 2 Y 1 A SER -16 ? A SER 4 25 2 Y 1 A HIS -15 ? A HIS 5 26 2 Y 1 A HIS -14 ? A HIS 6 27 2 Y 1 A HIS -13 ? A HIS 7 28 2 Y 1 A HIS -12 ? A HIS 8 29 2 Y 1 A HIS -11 ? A HIS 9 30 2 Y 1 A HIS -10 ? A HIS 10 31 2 Y 1 A SER -9 ? A SER 11 32 2 Y 1 A SER -8 ? A SER 12 33 2 Y 1 A GLY -7 ? A GLY 13 34 2 Y 1 A LEU -6 ? A LEU 14 35 2 Y 1 A VAL -5 ? A VAL 15 36 2 Y 1 A PRO -4 ? A PRO 16 37 2 Y 1 A ARG -3 ? A ARG 17 38 2 Y 1 A GLY -2 ? A GLY 18 39 2 Y 1 A SER -1 ? A SER 19 40 2 Y 1 A HIS 0 ? A HIS 20 41 3 Y 1 A MET -19 ? A MET 1 42 3 Y 1 A GLY -18 ? A GLY 2 43 3 Y 1 A SER -17 ? A SER 3 44 3 Y 1 A SER -16 ? A SER 4 45 3 Y 1 A HIS -15 ? A HIS 5 46 3 Y 1 A HIS -14 ? A HIS 6 47 3 Y 1 A HIS -13 ? A HIS 7 48 3 Y 1 A HIS -12 ? A HIS 8 49 3 Y 1 A HIS -11 ? A HIS 9 50 3 Y 1 A HIS -10 ? A HIS 10 51 3 Y 1 A SER -9 ? A SER 11 52 3 Y 1 A SER -8 ? A SER 12 53 3 Y 1 A GLY -7 ? A GLY 13 54 3 Y 1 A LEU -6 ? A LEU 14 55 3 Y 1 A VAL -5 ? A VAL 15 56 3 Y 1 A PRO -4 ? A PRO 16 57 3 Y 1 A ARG -3 ? A ARG 17 58 3 Y 1 A GLY -2 ? A GLY 18 59 3 Y 1 A SER -1 ? A SER 19 60 3 Y 1 A HIS 0 ? A HIS 20 61 4 Y 1 A MET -19 ? A MET 1 62 4 Y 1 A GLY -18 ? A GLY 2 63 4 Y 1 A SER -17 ? A SER 3 64 4 Y 1 A SER -16 ? A SER 4 65 4 Y 1 A HIS -15 ? A HIS 5 66 4 Y 1 A HIS -14 ? A HIS 6 67 4 Y 1 A HIS -13 ? A HIS 7 68 4 Y 1 A HIS -12 ? A HIS 8 69 4 Y 1 A HIS -11 ? A HIS 9 70 4 Y 1 A HIS -10 ? A HIS 10 71 4 Y 1 A SER -9 ? A SER 11 72 4 Y 1 A SER -8 ? A SER 12 73 4 Y 1 A GLY -7 ? A GLY 13 74 4 Y 1 A LEU -6 ? A LEU 14 75 4 Y 1 A VAL -5 ? A VAL 15 76 4 Y 1 A PRO -4 ? A PRO 16 77 4 Y 1 A ARG -3 ? A ARG 17 78 4 Y 1 A GLY -2 ? A GLY 18 79 4 Y 1 A SER -1 ? A SER 19 80 4 Y 1 A HIS 0 ? A HIS 20 81 5 Y 1 A MET -19 ? A MET 1 82 5 Y 1 A GLY -18 ? A GLY 2 83 5 Y 1 A SER -17 ? A SER 3 84 5 Y 1 A SER -16 ? A SER 4 85 5 Y 1 A HIS -15 ? A HIS 5 86 5 Y 1 A HIS -14 ? A HIS 6 87 5 Y 1 A HIS -13 ? A HIS 7 88 5 Y 1 A HIS -12 ? A HIS 8 89 5 Y 1 A HIS -11 ? A HIS 9 90 5 Y 1 A HIS -10 ? A HIS 10 91 5 Y 1 A SER -9 ? A SER 11 92 5 Y 1 A SER -8 ? A SER 12 93 5 Y 1 A GLY -7 ? A GLY 13 94 5 Y 1 A LEU -6 ? A LEU 14 95 5 Y 1 A VAL -5 ? A VAL 15 96 5 Y 1 A PRO -4 ? A PRO 16 97 5 Y 1 A ARG -3 ? A ARG 17 98 5 Y 1 A GLY -2 ? A GLY 18 99 5 Y 1 A SER -1 ? A SER 19 100 5 Y 1 A HIS 0 ? A HIS 20 101 6 Y 1 A MET -19 ? A MET 1 102 6 Y 1 A GLY -18 ? A GLY 2 103 6 Y 1 A SER -17 ? A SER 3 104 6 Y 1 A SER -16 ? A SER 4 105 6 Y 1 A HIS -15 ? A HIS 5 106 6 Y 1 A HIS -14 ? A HIS 6 107 6 Y 1 A HIS -13 ? A HIS 7 108 6 Y 1 A HIS -12 ? A HIS 8 109 6 Y 1 A HIS -11 ? A HIS 9 110 6 Y 1 A HIS -10 ? A HIS 10 111 6 Y 1 A SER -9 ? A SER 11 112 6 Y 1 A SER -8 ? A SER 12 113 6 Y 1 A GLY -7 ? A GLY 13 114 6 Y 1 A LEU -6 ? A LEU 14 115 6 Y 1 A VAL -5 ? A VAL 15 116 6 Y 1 A PRO -4 ? A PRO 16 117 6 Y 1 A ARG -3 ? A ARG 17 118 6 Y 1 A GLY -2 ? A GLY 18 119 6 Y 1 A SER -1 ? A SER 19 120 6 Y 1 A HIS 0 ? A HIS 20 121 7 Y 1 A MET -19 ? A MET 1 122 7 Y 1 A GLY -18 ? A GLY 2 123 7 Y 1 A SER -17 ? A SER 3 124 7 Y 1 A SER -16 ? A SER 4 125 7 Y 1 A HIS -15 ? A HIS 5 126 7 Y 1 A HIS -14 ? A HIS 6 127 7 Y 1 A HIS -13 ? A HIS 7 128 7 Y 1 A HIS -12 ? A HIS 8 129 7 Y 1 A HIS -11 ? A HIS 9 130 7 Y 1 A HIS -10 ? A HIS 10 131 7 Y 1 A SER -9 ? A SER 11 132 7 Y 1 A SER -8 ? A SER 12 133 7 Y 1 A GLY -7 ? A GLY 13 134 7 Y 1 A LEU -6 ? A LEU 14 135 7 Y 1 A VAL -5 ? A VAL 15 136 7 Y 1 A PRO -4 ? A PRO 16 137 7 Y 1 A ARG -3 ? A ARG 17 138 7 Y 1 A GLY -2 ? A GLY 18 139 7 Y 1 A SER -1 ? A SER 19 140 7 Y 1 A HIS 0 ? A HIS 20 141 8 Y 1 A MET -19 ? A MET 1 142 8 Y 1 A GLY -18 ? A GLY 2 143 8 Y 1 A SER -17 ? A SER 3 144 8 Y 1 A SER -16 ? A SER 4 145 8 Y 1 A HIS -15 ? A HIS 5 146 8 Y 1 A HIS -14 ? A HIS 6 147 8 Y 1 A HIS -13 ? A HIS 7 148 8 Y 1 A HIS -12 ? A HIS 8 149 8 Y 1 A HIS -11 ? A HIS 9 150 8 Y 1 A HIS -10 ? A HIS 10 151 8 Y 1 A SER -9 ? A SER 11 152 8 Y 1 A SER -8 ? A SER 12 153 8 Y 1 A GLY -7 ? A GLY 13 154 8 Y 1 A LEU -6 ? A LEU 14 155 8 Y 1 A VAL -5 ? A VAL 15 156 8 Y 1 A PRO -4 ? A PRO 16 157 8 Y 1 A ARG -3 ? A ARG 17 158 8 Y 1 A GLY -2 ? A GLY 18 159 8 Y 1 A SER -1 ? A SER 19 160 8 Y 1 A HIS 0 ? A HIS 20 161 9 Y 1 A MET -19 ? A MET 1 162 9 Y 1 A GLY -18 ? A GLY 2 163 9 Y 1 A SER -17 ? A SER 3 164 9 Y 1 A SER -16 ? A SER 4 165 9 Y 1 A HIS -15 ? A HIS 5 166 9 Y 1 A HIS -14 ? A HIS 6 167 9 Y 1 A HIS -13 ? A HIS 7 168 9 Y 1 A HIS -12 ? A HIS 8 169 9 Y 1 A HIS -11 ? A HIS 9 170 9 Y 1 A HIS -10 ? A HIS 10 171 9 Y 1 A SER -9 ? A SER 11 172 9 Y 1 A SER -8 ? A SER 12 173 9 Y 1 A GLY -7 ? A GLY 13 174 9 Y 1 A LEU -6 ? A LEU 14 175 9 Y 1 A VAL -5 ? A VAL 15 176 9 Y 1 A PRO -4 ? A PRO 16 177 9 Y 1 A ARG -3 ? A ARG 17 178 9 Y 1 A GLY -2 ? A GLY 18 179 9 Y 1 A SER -1 ? A SER 19 180 9 Y 1 A HIS 0 ? A HIS 20 181 10 Y 1 A MET -19 ? A MET 1 182 10 Y 1 A GLY -18 ? A GLY 2 183 10 Y 1 A SER -17 ? A SER 3 184 10 Y 1 A SER -16 ? A SER 4 185 10 Y 1 A HIS -15 ? A HIS 5 186 10 Y 1 A HIS -14 ? A HIS 6 187 10 Y 1 A HIS -13 ? A HIS 7 188 10 Y 1 A HIS -12 ? A HIS 8 189 10 Y 1 A HIS -11 ? A HIS 9 190 10 Y 1 A HIS -10 ? A HIS 10 191 10 Y 1 A SER -9 ? A SER 11 192 10 Y 1 A SER -8 ? A SER 12 193 10 Y 1 A GLY -7 ? A GLY 13 194 10 Y 1 A LEU -6 ? A LEU 14 195 10 Y 1 A VAL -5 ? A VAL 15 196 10 Y 1 A PRO -4 ? A PRO 16 197 10 Y 1 A ARG -3 ? A ARG 17 198 10 Y 1 A GLY -2 ? A GLY 18 199 10 Y 1 A SER -1 ? A SER 19 200 10 Y 1 A HIS 0 ? A HIS 20 201 11 Y 1 A MET -19 ? A MET 1 202 11 Y 1 A GLY -18 ? A GLY 2 203 11 Y 1 A SER -17 ? A SER 3 204 11 Y 1 A SER -16 ? A SER 4 205 11 Y 1 A HIS -15 ? A HIS 5 206 11 Y 1 A HIS -14 ? A HIS 6 207 11 Y 1 A HIS -13 ? A HIS 7 208 11 Y 1 A HIS -12 ? A HIS 8 209 11 Y 1 A HIS -11 ? A HIS 9 210 11 Y 1 A HIS -10 ? A HIS 10 211 11 Y 1 A SER -9 ? A SER 11 212 11 Y 1 A SER -8 ? A SER 12 213 11 Y 1 A GLY -7 ? A GLY 13 214 11 Y 1 A LEU -6 ? A LEU 14 215 11 Y 1 A VAL -5 ? A VAL 15 216 11 Y 1 A PRO -4 ? A PRO 16 217 11 Y 1 A ARG -3 ? A ARG 17 218 11 Y 1 A GLY -2 ? A GLY 18 219 11 Y 1 A SER -1 ? A SER 19 220 11 Y 1 A HIS 0 ? A HIS 20 221 12 Y 1 A MET -19 ? A MET 1 222 12 Y 1 A GLY -18 ? A GLY 2 223 12 Y 1 A SER -17 ? A SER 3 224 12 Y 1 A SER -16 ? A SER 4 225 12 Y 1 A HIS -15 ? A HIS 5 226 12 Y 1 A HIS -14 ? A HIS 6 227 12 Y 1 A HIS -13 ? A HIS 7 228 12 Y 1 A HIS -12 ? A HIS 8 229 12 Y 1 A HIS -11 ? A HIS 9 230 12 Y 1 A HIS -10 ? A HIS 10 231 12 Y 1 A SER -9 ? A SER 11 232 12 Y 1 A SER -8 ? A SER 12 233 12 Y 1 A GLY -7 ? A GLY 13 234 12 Y 1 A LEU -6 ? A LEU 14 235 12 Y 1 A VAL -5 ? A VAL 15 236 12 Y 1 A PRO -4 ? A PRO 16 237 12 Y 1 A ARG -3 ? A ARG 17 238 12 Y 1 A GLY -2 ? A GLY 18 239 12 Y 1 A SER -1 ? A SER 19 240 12 Y 1 A HIS 0 ? A HIS 20 241 13 Y 1 A MET -19 ? A MET 1 242 13 Y 1 A GLY -18 ? A GLY 2 243 13 Y 1 A SER -17 ? A SER 3 244 13 Y 1 A SER -16 ? A SER 4 245 13 Y 1 A HIS -15 ? A HIS 5 246 13 Y 1 A HIS -14 ? A HIS 6 247 13 Y 1 A HIS -13 ? A HIS 7 248 13 Y 1 A HIS -12 ? A HIS 8 249 13 Y 1 A HIS -11 ? A HIS 9 250 13 Y 1 A HIS -10 ? A HIS 10 251 13 Y 1 A SER -9 ? A SER 11 252 13 Y 1 A SER -8 ? A SER 12 253 13 Y 1 A GLY -7 ? A GLY 13 254 13 Y 1 A LEU -6 ? A LEU 14 255 13 Y 1 A VAL -5 ? A VAL 15 256 13 Y 1 A PRO -4 ? A PRO 16 257 13 Y 1 A ARG -3 ? A ARG 17 258 13 Y 1 A GLY -2 ? A GLY 18 259 13 Y 1 A SER -1 ? A SER 19 260 13 Y 1 A HIS 0 ? A HIS 20 261 14 Y 1 A MET -19 ? A MET 1 262 14 Y 1 A GLY -18 ? A GLY 2 263 14 Y 1 A SER -17 ? A SER 3 264 14 Y 1 A SER -16 ? A SER 4 265 14 Y 1 A HIS -15 ? A HIS 5 266 14 Y 1 A HIS -14 ? A HIS 6 267 14 Y 1 A HIS -13 ? A HIS 7 268 14 Y 1 A HIS -12 ? A HIS 8 269 14 Y 1 A HIS -11 ? A HIS 9 270 14 Y 1 A HIS -10 ? A HIS 10 271 14 Y 1 A SER -9 ? A SER 11 272 14 Y 1 A SER -8 ? A SER 12 273 14 Y 1 A GLY -7 ? A GLY 13 274 14 Y 1 A LEU -6 ? A LEU 14 275 14 Y 1 A VAL -5 ? A VAL 15 276 14 Y 1 A PRO -4 ? A PRO 16 277 14 Y 1 A ARG -3 ? A ARG 17 278 14 Y 1 A GLY -2 ? A GLY 18 279 14 Y 1 A SER -1 ? A SER 19 280 14 Y 1 A HIS 0 ? A HIS 20 281 15 Y 1 A MET -19 ? A MET 1 282 15 Y 1 A GLY -18 ? A GLY 2 283 15 Y 1 A SER -17 ? A SER 3 284 15 Y 1 A SER -16 ? A SER 4 285 15 Y 1 A HIS -15 ? A HIS 5 286 15 Y 1 A HIS -14 ? A HIS 6 287 15 Y 1 A HIS -13 ? A HIS 7 288 15 Y 1 A HIS -12 ? A HIS 8 289 15 Y 1 A HIS -11 ? A HIS 9 290 15 Y 1 A HIS -10 ? A HIS 10 291 15 Y 1 A SER -9 ? A SER 11 292 15 Y 1 A SER -8 ? A SER 12 293 15 Y 1 A GLY -7 ? A GLY 13 294 15 Y 1 A LEU -6 ? A LEU 14 295 15 Y 1 A VAL -5 ? A VAL 15 296 15 Y 1 A PRO -4 ? A PRO 16 297 15 Y 1 A ARG -3 ? A ARG 17 298 15 Y 1 A GLY -2 ? A GLY 18 299 15 Y 1 A SER -1 ? A SER 19 300 15 Y 1 A HIS 0 ? A HIS 20 301 16 Y 1 A MET -19 ? A MET 1 302 16 Y 1 A GLY -18 ? A GLY 2 303 16 Y 1 A SER -17 ? A SER 3 304 16 Y 1 A SER -16 ? A SER 4 305 16 Y 1 A HIS -15 ? A HIS 5 306 16 Y 1 A HIS -14 ? A HIS 6 307 16 Y 1 A HIS -13 ? A HIS 7 308 16 Y 1 A HIS -12 ? A HIS 8 309 16 Y 1 A HIS -11 ? A HIS 9 310 16 Y 1 A HIS -10 ? A HIS 10 311 16 Y 1 A SER -9 ? A SER 11 312 16 Y 1 A SER -8 ? A SER 12 313 16 Y 1 A GLY -7 ? A GLY 13 314 16 Y 1 A LEU -6 ? A LEU 14 315 16 Y 1 A VAL -5 ? A VAL 15 316 16 Y 1 A PRO -4 ? A PRO 16 317 16 Y 1 A ARG -3 ? A ARG 17 318 16 Y 1 A GLY -2 ? A GLY 18 319 16 Y 1 A SER -1 ? A SER 19 320 16 Y 1 A HIS 0 ? A HIS 20 321 17 Y 1 A MET -19 ? A MET 1 322 17 Y 1 A GLY -18 ? A GLY 2 323 17 Y 1 A SER -17 ? A SER 3 324 17 Y 1 A SER -16 ? A SER 4 325 17 Y 1 A HIS -15 ? A HIS 5 326 17 Y 1 A HIS -14 ? A HIS 6 327 17 Y 1 A HIS -13 ? A HIS 7 328 17 Y 1 A HIS -12 ? A HIS 8 329 17 Y 1 A HIS -11 ? A HIS 9 330 17 Y 1 A HIS -10 ? A HIS 10 331 17 Y 1 A SER -9 ? A SER 11 332 17 Y 1 A SER -8 ? A SER 12 333 17 Y 1 A GLY -7 ? A GLY 13 334 17 Y 1 A LEU -6 ? A LEU 14 335 17 Y 1 A VAL -5 ? A VAL 15 336 17 Y 1 A PRO -4 ? A PRO 16 337 17 Y 1 A ARG -3 ? A ARG 17 338 17 Y 1 A GLY -2 ? A GLY 18 339 17 Y 1 A SER -1 ? A SER 19 340 17 Y 1 A HIS 0 ? A HIS 20 341 18 Y 1 A MET -19 ? A MET 1 342 18 Y 1 A GLY -18 ? A GLY 2 343 18 Y 1 A SER -17 ? A SER 3 344 18 Y 1 A SER -16 ? A SER 4 345 18 Y 1 A HIS -15 ? A HIS 5 346 18 Y 1 A HIS -14 ? A HIS 6 347 18 Y 1 A HIS -13 ? A HIS 7 348 18 Y 1 A HIS -12 ? A HIS 8 349 18 Y 1 A HIS -11 ? A HIS 9 350 18 Y 1 A HIS -10 ? A HIS 10 351 18 Y 1 A SER -9 ? A SER 11 352 18 Y 1 A SER -8 ? A SER 12 353 18 Y 1 A GLY -7 ? A GLY 13 354 18 Y 1 A LEU -6 ? A LEU 14 355 18 Y 1 A VAL -5 ? A VAL 15 356 18 Y 1 A PRO -4 ? A PRO 16 357 18 Y 1 A ARG -3 ? A ARG 17 358 18 Y 1 A GLY -2 ? A GLY 18 359 18 Y 1 A SER -1 ? A SER 19 360 18 Y 1 A HIS 0 ? A HIS 20 361 19 Y 1 A MET -19 ? A MET 1 362 19 Y 1 A GLY -18 ? A GLY 2 363 19 Y 1 A SER -17 ? A SER 3 364 19 Y 1 A SER -16 ? A SER 4 365 19 Y 1 A HIS -15 ? A HIS 5 366 19 Y 1 A HIS -14 ? A HIS 6 367 19 Y 1 A HIS -13 ? A HIS 7 368 19 Y 1 A HIS -12 ? A HIS 8 369 19 Y 1 A HIS -11 ? A HIS 9 370 19 Y 1 A HIS -10 ? A HIS 10 371 19 Y 1 A SER -9 ? A SER 11 372 19 Y 1 A SER -8 ? A SER 12 373 19 Y 1 A GLY -7 ? A GLY 13 374 19 Y 1 A LEU -6 ? A LEU 14 375 19 Y 1 A VAL -5 ? A VAL 15 376 19 Y 1 A PRO -4 ? A PRO 16 377 19 Y 1 A ARG -3 ? A ARG 17 378 19 Y 1 A GLY -2 ? A GLY 18 379 19 Y 1 A SER -1 ? A SER 19 380 19 Y 1 A HIS 0 ? A HIS 20 381 20 Y 1 A MET -19 ? A MET 1 382 20 Y 1 A GLY -18 ? A GLY 2 383 20 Y 1 A SER -17 ? A SER 3 384 20 Y 1 A SER -16 ? A SER 4 385 20 Y 1 A HIS -15 ? A HIS 5 386 20 Y 1 A HIS -14 ? A HIS 6 387 20 Y 1 A HIS -13 ? A HIS 7 388 20 Y 1 A HIS -12 ? A HIS 8 389 20 Y 1 A HIS -11 ? A HIS 9 390 20 Y 1 A HIS -10 ? A HIS 10 391 20 Y 1 A SER -9 ? A SER 11 392 20 Y 1 A SER -8 ? A SER 12 393 20 Y 1 A GLY -7 ? A GLY 13 394 20 Y 1 A LEU -6 ? A LEU 14 395 20 Y 1 A VAL -5 ? A VAL 15 396 20 Y 1 A PRO -4 ? A PRO 16 397 20 Y 1 A ARG -3 ? A ARG 17 398 20 Y 1 A GLY -2 ? A GLY 18 399 20 Y 1 A SER -1 ? A SER 19 400 20 Y 1 A HIS 0 ? A HIS 20 #