data_2FC7 # _entry.id 2FC7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2FC7 pdb_00002fc7 10.2210/pdb2fc7/pdb RCSB RCSB035705 ? ? WWPDB D_1000035705 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002027679.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2FC7 _pdbx_database_status.recvd_initial_deposition_date 2005-12-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dang, W.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Shirouzu, M.' 4 'Terada, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the ZZ domain of ZZZ3 protein' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dang, W.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ZZZ3 protein' 8953.745 1 ? ? 'ZZ domain, residues 8-76' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGQQMQAESGFVQHVGFKCDNCGIEPIQGVRWHCQDCPPEMSLDFCDSCSDCLHETDIHKEDHQLEPIYRSSGPS SG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGQQMQAESGFVQHVGFKCDNCGIEPIQGVRWHCQDCPPEMSLDFCDSCSDCLHETDIHKEDHQLEPIYRSSGPS SG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002027679.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLN n 1 9 GLN n 1 10 MET n 1 11 GLN n 1 12 ALA n 1 13 GLU n 1 14 SER n 1 15 GLY n 1 16 PHE n 1 17 VAL n 1 18 GLN n 1 19 HIS n 1 20 VAL n 1 21 GLY n 1 22 PHE n 1 23 LYS n 1 24 CYS n 1 25 ASP n 1 26 ASN n 1 27 CYS n 1 28 GLY n 1 29 ILE n 1 30 GLU n 1 31 PRO n 1 32 ILE n 1 33 GLN n 1 34 GLY n 1 35 VAL n 1 36 ARG n 1 37 TRP n 1 38 HIS n 1 39 CYS n 1 40 GLN n 1 41 ASP n 1 42 CYS n 1 43 PRO n 1 44 PRO n 1 45 GLU n 1 46 MET n 1 47 SER n 1 48 LEU n 1 49 ASP n 1 50 PHE n 1 51 CYS n 1 52 ASP n 1 53 SER n 1 54 CYS n 1 55 SER n 1 56 ASP n 1 57 CYS n 1 58 LEU n 1 59 HIS n 1 60 GLU n 1 61 THR n 1 62 ASP n 1 63 ILE n 1 64 HIS n 1 65 LYS n 1 66 GLU n 1 67 ASP n 1 68 HIS n 1 69 GLN n 1 70 LEU n 1 71 GLU n 1 72 PRO n 1 73 ILE n 1 74 TYR n 1 75 ARG n 1 76 SER n 1 77 SER n 1 78 GLY n 1 79 PRO n 1 80 SER n 1 81 SER n 1 82 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ZZZ3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cell free protein synthesis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050302-92 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code AAH35079 _struct_ref.pdbx_db_accession 23272439 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QQMQAESGFVQHVGFKCDNCGIEPIQGVRWHCQDCPPEMSLDFCDSCSDCLHETDIHKEDHQLEPIYRS _struct_ref.pdbx_align_begin 313 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2FC7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 76 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 23272439 _struct_ref_seq.db_align_beg 313 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 381 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 76 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2FC7 GLY A 1 ? GB 23272439 ? ? 'cloning artifact' 1 1 1 2FC7 SER A 2 ? GB 23272439 ? ? 'cloning artifact' 2 2 1 2FC7 SER A 3 ? GB 23272439 ? ? 'cloning artifact' 3 3 1 2FC7 GLY A 4 ? GB 23272439 ? ? 'cloning artifact' 4 4 1 2FC7 SER A 5 ? GB 23272439 ? ? 'cloning artifact' 5 5 1 2FC7 SER A 6 ? GB 23272439 ? ? 'cloning artifact' 6 6 1 2FC7 GLY A 7 ? GB 23272439 ? ? 'cloning artifact' 7 7 1 2FC7 SER A 77 ? GB 23272439 ? ? 'cloning artifact' 77 8 1 2FC7 GLY A 78 ? GB 23272439 ? ? 'cloning artifact' 78 9 1 2FC7 PRO A 79 ? GB 23272439 ? ? 'cloning artifact' 79 10 1 2FC7 SER A 80 ? GB 23272439 ? ? 'cloning artifact' 80 11 1 2FC7 SER A 81 ? GB 23272439 ? ? 'cloning artifact' 81 12 1 2FC7 GLY A 82 ? GB 23272439 ? ? 'cloning artifact' 82 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 50uM ZnCl2+1mM IDA; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2FC7 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2FC7 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,structures with the lowest energy,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2FC7 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.9321 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # _exptl.entry_id 2FC7 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2FC7 _struct.title 'Solution structure of the ZZ domain of ZZZ3 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2FC7 _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text ;structure genomics, ZZ domain, ZZZ3 protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 52 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 54 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 52 _struct_conf.end_auth_comp_id CYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 54 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 24 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 24 A ZN 201 1_555 ? ? ? ? ? ? ? 2.249 ? ? metalc2 metalc ? ? A CYS 27 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 27 A ZN 201 1_555 ? ? ? ? ? ? ? 2.250 ? ? metalc3 metalc ? ? A CYS 39 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 39 A ZN 401 1_555 ? ? ? ? ? ? ? 2.292 ? ? metalc4 metalc ? ? A CYS 42 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 42 A ZN 401 1_555 ? ? ? ? ? ? ? 2.352 ? ? metalc5 metalc ? ? A CYS 51 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 51 A ZN 201 1_555 ? ? ? ? ? ? ? 2.247 ? ? metalc6 metalc ? ? A CYS 54 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 54 A ZN 201 1_555 ? ? ? ? ? ? ? 2.349 ? ? metalc7 metalc ? ? A HIS 64 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 64 A ZN 401 1_555 ? ? ? ? ? ? ? 2.052 ? ? metalc8 metalc ? ? A HIS 68 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 68 A ZN 401 1_555 ? ? ? ? ? ? ? 2.053 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 1 -0.05 2 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 2 -0.03 3 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 3 -0.09 4 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 4 0.01 5 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 5 -0.04 6 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 6 0.01 7 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 7 0.05 8 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 8 -0.07 9 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 9 0.00 10 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 10 0.00 11 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 11 -0.06 12 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 12 0.01 13 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 13 -0.10 14 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 14 0.02 15 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 15 -0.05 16 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 16 -0.02 17 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 17 -0.13 18 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 18 -0.02 19 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 19 -0.04 20 GLU 30 A . ? GLU 30 A PRO 31 A ? PRO 31 A 20 -0.03 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 18 ? HIS A 19 ? GLN A 18 HIS A 19 A 2 ILE A 32 ? GLN A 33 ? ILE A 32 GLN A 33 B 1 ASP A 49 ? CYS A 51 ? ASP A 49 CYS A 51 B 2 ARG A 36 ? CYS A 39 ? ARG A 36 CYS A 39 B 3 LEU A 70 ? ILE A 73 ? LEU A 70 ILE A 73 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N HIS A 19 ? N HIS A 19 O ILE A 32 ? O ILE A 32 B 1 2 O PHE A 50 ? O PHE A 50 N TRP A 37 ? N TRP A 37 B 2 3 N ARG A 36 ? N ARG A 36 O ILE A 73 ? O ILE A 73 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 24 ? CYS A 24 . ? 1_555 ? 2 AC1 4 CYS A 27 ? CYS A 27 . ? 1_555 ? 3 AC1 4 CYS A 51 ? CYS A 51 . ? 1_555 ? 4 AC1 4 CYS A 54 ? CYS A 54 . ? 1_555 ? 5 AC2 4 CYS A 39 ? CYS A 39 . ? 1_555 ? 6 AC2 4 CYS A 42 ? CYS A 42 . ? 1_555 ? 7 AC2 4 HIS A 64 ? HIS A 64 . ? 1_555 ? 8 AC2 4 HIS A 68 ? HIS A 68 . ? 1_555 ? # _database_PDB_matrix.entry_id 2FC7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2FC7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 GLY 82 82 82 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 24 ? A CYS 24 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 27 ? A CYS 27 ? 1_555 108.3 ? 2 SG ? A CYS 24 ? A CYS 24 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 51 ? A CYS 51 ? 1_555 108.5 ? 3 SG ? A CYS 27 ? A CYS 27 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 51 ? A CYS 51 ? 1_555 117.9 ? 4 SG ? A CYS 24 ? A CYS 24 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 105.6 ? 5 SG ? A CYS 27 ? A CYS 27 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 110.8 ? 6 SG ? A CYS 51 ? A CYS 51 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 54 ? A CYS 54 ? 1_555 105.0 ? 7 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 103.9 ? 8 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 64 ? A HIS 64 ? 1_555 107.2 ? 9 SG ? A CYS 42 ? A CYS 42 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 64 ? A HIS 64 ? 1_555 106.9 ? 10 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 68 ? A HIS 68 ? 1_555 115.8 ? 11 SG ? A CYS 42 ? A CYS 42 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 68 ? A HIS 68 ? 1_555 105.0 ? 12 ND1 ? A HIS 64 ? A HIS 64 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 68 ? A HIS 68 ? 1_555 116.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-12 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.value' 18 4 'Structure model' '_struct_conn.pdbx_dist_value' 19 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 31 4 'Structure model' '_struct_ref_seq_dif.details' 32 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 33 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 34 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? -173.86 129.03 2 1 GLN A 9 ? ? -172.03 138.71 3 1 MET A 10 ? ? 38.25 36.62 4 1 ALA A 12 ? ? -67.05 86.10 5 1 SER A 14 ? ? -35.16 102.86 6 1 ASN A 26 ? ? -120.44 -60.97 7 1 CYS A 42 ? ? -48.19 152.14 8 1 ASP A 52 ? ? -38.56 -35.69 9 1 HIS A 68 ? ? -47.54 158.82 10 1 SER A 81 ? ? -41.78 158.74 11 2 GLN A 9 ? ? 36.13 43.55 12 2 MET A 10 ? ? -102.71 41.56 13 2 CYS A 42 ? ? -49.55 151.11 14 2 ASP A 52 ? ? -35.35 -32.93 15 2 SER A 77 ? ? -99.48 43.75 16 2 PRO A 79 ? ? -69.77 0.16 17 3 GLN A 9 ? ? 37.40 41.68 18 3 ALA A 12 ? ? -165.92 108.33 19 3 SER A 14 ? ? -35.65 126.54 20 3 TRP A 37 ? ? -67.47 98.57 21 3 CYS A 42 ? ? -44.87 152.29 22 3 ASP A 52 ? ? -37.03 -28.75 23 4 MET A 10 ? ? -63.81 96.37 24 4 TRP A 37 ? ? -67.33 96.28 25 4 CYS A 42 ? ? -44.52 151.44 26 4 ASP A 52 ? ? -35.79 -33.46 27 4 HIS A 68 ? ? -46.48 153.06 28 4 SER A 77 ? ? 36.27 40.47 29 5 TRP A 37 ? ? -65.78 95.22 30 5 CYS A 42 ? ? -46.96 152.89 31 5 ASP A 52 ? ? -34.02 -34.34 32 5 PRO A 79 ? ? -69.77 86.78 33 6 ASN A 26 ? ? -128.79 -62.38 34 6 CYS A 42 ? ? -42.63 150.63 35 6 ASP A 52 ? ? -39.07 -37.18 36 6 HIS A 68 ? ? -46.89 156.65 37 6 PRO A 72 ? ? -69.68 99.60 38 7 MET A 10 ? ? -168.31 118.68 39 7 PRO A 44 ? ? -69.80 0.93 40 7 ASP A 52 ? ? -35.10 -33.61 41 7 HIS A 68 ? ? -47.81 151.99 42 8 SER A 3 ? ? -81.57 44.10 43 8 ASN A 26 ? ? -122.30 -63.97 44 8 ASP A 52 ? ? -35.56 -37.17 45 8 HIS A 68 ? ? -41.76 157.89 46 9 MET A 10 ? ? -35.96 99.37 47 9 CYS A 42 ? ? -49.94 150.90 48 9 PRO A 44 ? ? -69.78 1.60 49 9 ASP A 52 ? ? -35.63 -35.78 50 9 HIS A 68 ? ? -46.46 161.28 51 10 SER A 6 ? ? -164.91 114.82 52 10 TRP A 37 ? ? -68.62 97.81 53 10 CYS A 42 ? ? -43.44 153.86 54 10 ASP A 52 ? ? -39.82 -34.21 55 10 HIS A 68 ? ? -46.21 153.35 56 10 PRO A 72 ? ? -69.76 99.84 57 10 SER A 80 ? ? -85.52 41.03 58 10 SER A 81 ? ? -100.30 43.93 59 11 SER A 3 ? ? -47.86 150.66 60 11 ASN A 26 ? ? -97.06 -69.19 61 11 PRO A 44 ? ? -69.80 0.40 62 11 ASP A 52 ? ? -38.51 -37.51 63 11 HIS A 68 ? ? -48.65 155.68 64 12 TRP A 37 ? ? -66.79 96.01 65 12 CYS A 42 ? ? -48.75 151.63 66 12 ASP A 52 ? ? -39.77 -33.78 67 12 HIS A 68 ? ? -43.19 159.46 68 12 SER A 77 ? ? -38.34 154.32 69 13 MET A 10 ? ? -171.27 139.59 70 13 ASN A 26 ? ? -97.83 -70.76 71 13 TRP A 37 ? ? -68.35 95.38 72 13 CYS A 42 ? ? -45.00 153.35 73 13 ASP A 52 ? ? -38.25 -29.89 74 13 SER A 81 ? ? -41.77 151.34 75 14 CYS A 42 ? ? -44.35 152.31 76 14 ASP A 52 ? ? -35.40 -35.71 77 14 HIS A 68 ? ? -47.59 150.86 78 15 ALA A 12 ? ? -164.02 110.01 79 15 TRP A 37 ? ? -67.96 96.54 80 15 CYS A 42 ? ? -46.38 150.83 81 15 ASP A 52 ? ? -35.14 -35.83 82 15 PRO A 72 ? ? -69.82 97.19 83 16 ASP A 52 ? ? -36.67 -34.16 84 16 HIS A 68 ? ? -45.26 161.68 85 16 SER A 77 ? ? -58.04 99.85 86 16 PRO A 79 ? ? -69.78 85.60 87 17 GLN A 9 ? ? -132.42 -43.34 88 17 SER A 14 ? ? -174.46 134.28 89 17 ASN A 26 ? ? -104.92 -70.44 90 17 CYS A 42 ? ? -46.32 151.84 91 17 ASP A 52 ? ? -36.09 -33.17 92 17 SER A 77 ? ? -67.01 82.12 93 18 SER A 3 ? ? -55.55 100.79 94 18 SER A 5 ? ? -174.51 140.99 95 18 ASN A 26 ? ? -120.64 -62.96 96 18 CYS A 42 ? ? -47.27 151.25 97 18 HIS A 68 ? ? -46.20 157.60 98 18 SER A 77 ? ? 36.84 47.58 99 18 PRO A 79 ? ? -69.80 2.82 100 19 GLU A 13 ? ? -87.66 46.33 101 19 CYS A 42 ? ? -46.73 151.74 102 19 ASP A 52 ? ? -37.60 -37.25 103 19 HIS A 68 ? ? -45.36 164.18 104 19 PRO A 79 ? ? -69.71 97.94 105 20 SER A 2 ? ? -80.51 44.73 106 20 SER A 5 ? ? -45.35 158.87 107 20 GLU A 13 ? ? -38.70 158.14 108 20 ASN A 26 ? ? -121.16 -62.05 109 20 CYS A 42 ? ? -49.16 151.51 110 20 HIS A 68 ? ? -43.68 160.47 111 20 PRO A 79 ? ? -69.81 -175.12 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #