data_2FEJ # _entry.id 2FEJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2FEJ pdb_00002fej 10.2210/pdb2fej/pdb RCSB RCSB035782 ? ? WWPDB D_1000035782 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2FEJ _pdbx_database_status.recvd_initial_deposition_date 2005-12-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Perez-Canadillas, J.M.' 1 'Tidow, H.' 2 'Freund, S.M.' 3 'Rutherford, T.J.' 4 'Ang, H.C.' 5 'Fersht, A.R.' 6 # _citation.id primary _citation.title 'Solution structure of p53 core domain: Structural basis for its instability' _citation.journal_abbrev Proc.Natl.Acad.Sci.Usa _citation.journal_volume 103 _citation.page_first 2109 _citation.page_last 2114 _citation.year 2006 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16461916 _citation.pdbx_database_id_DOI 10.1073/pnas.0510941103 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Perez-Canadillas, J.M.' 1 ? primary 'Tidow, H.' 2 ? primary 'Freund, S.M.' 3 ? primary 'Rutherford, T.J.' 4 ? primary 'Ang, H.C.' 5 ? primary 'Fersht, A.R.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cellular tumor antigen p53' 23008.105 1 ? ? 'DNA binding domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Tumor suppressor p53, Phosphoprotein p53, Antigen NY-CO-13' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVV RRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILT IITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHH ; _entity_poly.pdbx_seq_one_letter_code_can ;SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVV RRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILT IITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 SER n 1 3 SER n 1 4 VAL n 1 5 PRO n 1 6 SER n 1 7 GLN n 1 8 LYS n 1 9 THR n 1 10 TYR n 1 11 GLN n 1 12 GLY n 1 13 SER n 1 14 TYR n 1 15 GLY n 1 16 PHE n 1 17 ARG n 1 18 LEU n 1 19 GLY n 1 20 PHE n 1 21 LEU n 1 22 HIS n 1 23 SER n 1 24 GLY n 1 25 THR n 1 26 ALA n 1 27 LYS n 1 28 SER n 1 29 VAL n 1 30 THR n 1 31 CYS n 1 32 THR n 1 33 TYR n 1 34 SER n 1 35 PRO n 1 36 ALA n 1 37 LEU n 1 38 ASN n 1 39 LYS n 1 40 MET n 1 41 PHE n 1 42 CYS n 1 43 GLN n 1 44 LEU n 1 45 ALA n 1 46 LYS n 1 47 THR n 1 48 CYS n 1 49 PRO n 1 50 VAL n 1 51 GLN n 1 52 LEU n 1 53 TRP n 1 54 VAL n 1 55 ASP n 1 56 SER n 1 57 THR n 1 58 PRO n 1 59 PRO n 1 60 PRO n 1 61 GLY n 1 62 THR n 1 63 ARG n 1 64 VAL n 1 65 ARG n 1 66 ALA n 1 67 MET n 1 68 ALA n 1 69 ILE n 1 70 TYR n 1 71 LYS n 1 72 GLN n 1 73 SER n 1 74 GLN n 1 75 HIS n 1 76 MET n 1 77 THR n 1 78 GLU n 1 79 VAL n 1 80 VAL n 1 81 ARG n 1 82 ARG n 1 83 CYS n 1 84 PRO n 1 85 HIS n 1 86 HIS n 1 87 GLU n 1 88 ARG n 1 89 CYS n 1 90 SER n 1 91 ASP n 1 92 SER n 1 93 ASP n 1 94 GLY n 1 95 LEU n 1 96 ALA n 1 97 PRO n 1 98 PRO n 1 99 GLN n 1 100 HIS n 1 101 LEU n 1 102 ILE n 1 103 ARG n 1 104 VAL n 1 105 GLU n 1 106 GLY n 1 107 ASN n 1 108 LEU n 1 109 ARG n 1 110 VAL n 1 111 GLU n 1 112 TYR n 1 113 LEU n 1 114 ASP n 1 115 ASP n 1 116 ARG n 1 117 ASN n 1 118 THR n 1 119 PHE n 1 120 ARG n 1 121 HIS n 1 122 SER n 1 123 VAL n 1 124 VAL n 1 125 VAL n 1 126 PRO n 1 127 TYR n 1 128 GLU n 1 129 PRO n 1 130 PRO n 1 131 GLU n 1 132 VAL n 1 133 GLY n 1 134 SER n 1 135 ASP n 1 136 CYS n 1 137 THR n 1 138 THR n 1 139 ILE n 1 140 HIS n 1 141 TYR n 1 142 ASN n 1 143 TYR n 1 144 MET n 1 145 CYS n 1 146 ASN n 1 147 SER n 1 148 SER n 1 149 CYS n 1 150 MET n 1 151 GLY n 1 152 GLY n 1 153 MET n 1 154 ASN n 1 155 ARG n 1 156 ARG n 1 157 PRO n 1 158 ILE n 1 159 LEU n 1 160 THR n 1 161 ILE n 1 162 ILE n 1 163 THR n 1 164 LEU n 1 165 GLU n 1 166 ASP n 1 167 SER n 1 168 SER n 1 169 GLY n 1 170 ASN n 1 171 LEU n 1 172 LEU n 1 173 GLY n 1 174 ARG n 1 175 ASN n 1 176 SER n 1 177 PHE n 1 178 GLU n 1 179 VAL n 1 180 ARG n 1 181 VAL n 1 182 CYS n 1 183 ALA n 1 184 CYS n 1 185 PRO n 1 186 GLY n 1 187 ARG n 1 188 ASP n 1 189 ARG n 1 190 ARG n 1 191 THR n 1 192 GLU n 1 193 GLU n 1 194 GLU n 1 195 ASN n 1 196 LEU n 1 197 ARG n 1 198 LYS n 1 199 LYS n 1 200 GLY n 1 201 GLU n 1 202 PRO n 1 203 HIS n 1 204 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'TP53, P53' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'C41(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pRSET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code P53_HUMAN _struct_ref.pdbx_db_accession Q9NP68 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVV RRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILT IITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHH ; _struct_ref.pdbx_align_begin 94 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2FEJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 204 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NP68 _struct_ref_seq.db_align_beg 94 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 297 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 94 _struct_ref_seq.pdbx_auth_seq_align_end 297 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 3D_15N-separated_NOESY 1 3 1 '2D NOESY' 2 4 1 3D_13C-separated_NOESY 2 5 1 '2D NOESY' 3 6 1 3D_13C-separated_NOESY 3 7 1 '2D NOESY' 4 8 1 '2D NOESY' 5 9 1 '2D NOESY' 6 10 1 '2D NOESY' 7 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength '150 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.4 mM p53 core U-15N,13C, 2H; 25 mM Tris-HCl pH 7.1; 150 mM NaCl; 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 ;0.3 mM p53 core U-15N,13C, 2H + reverse ILV 13CH3 ; 25 mM Tris-HCl pH 7.1; 150 mM NaCl; 90% H2O, 10% D2O ; '90% H2O/10% D2O' 3 '0.3 mM p53 core U-15N,13C, 2H + reverse ILV 13CH3 + reverse Tyr ; 25 mM Tris-HCl pH 7.1; 150 mM NaCl; 100% D2O' '100% D2O' 4 '0.3 mM p53 core U-15N,13C, 2H + Met and Phe (1H); 25 mM Tris-HCl pH 7.1; 150 mM NaCl; 90% H2O, 10% D2O' '90% H2O/10% D2O' 5 '0.3 mM p53 core U-15N,13C, 2H + Met and Arg (1H); 25 mM Tris-HCl pH 7.1; 150 mM NaCl; 90% H2O, 10% D2O' '90% H2O/10% D2O' 6 '0.4 mM p53 core U-15N,13C, 2H (50%); 25 mM Tris-HCl pH 7.1; 150 mM NaCl; 90% H2O, 10% D2O' '90% H2O/10% D2O' 7 '0.4 mM p53 core N/A; 25 mM Tris-HCl pH 7.1; 150 mM NaCl; 90% H2O, 10% D2O' '90% H2O/10% D2O' 8 '0.4 mM p53 core N/A; 25 mM Tris-HCl pH 7.1; 150 mM NaCl; 100% D2O' '100% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DMX Bruker 600 ? 2 AVANCE Bruker 800 ? 3 DRX Bruker 500 ? # _pdbx_nmr_refine.entry_id 2FEJ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2FEJ _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 36 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2FEJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_software.classification 'data analysis' _pdbx_nmr_software.name CNS _pdbx_nmr_software.version 1.0 _pdbx_nmr_software.authors 'Brunger et al' _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 2FEJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2FEJ _struct.title 'Solution structure of human p53 DNA binding domain.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2FEJ _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'BETA SANDWICH, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 72 ? MET A 76 ? GLN A 165 MET A 169 5 ? 5 HELX_P HELX_P2 2 CYS A 83 ? SER A 90 ? CYS A 176 SER A 183 1 ? 8 HELX_P HELX_P3 3 CYS A 184 ? LYS A 199 ? CYS A 277 LYS A 292 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 83 SG ? ? A ZN 1 A CYS 176 1_555 ? ? ? ? ? ? ? 2.351 ? ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 86 ND1 ? ? A ZN 1 A HIS 179 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 145 SG ? ? A ZN 1 A CYS 238 1_555 ? ? ? ? ? ? ? 2.413 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 149 SG ? ? A ZN 1 A CYS 242 1_555 ? ? ? ? ? ? ? 2.413 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 17 ? GLY A 19 ? ARG A 110 GLY A 112 A 2 THR A 47 ? TRP A 53 ? THR A 140 TRP A 146 A 3 THR A 137 ? TYR A 143 ? THR A 230 TYR A 236 A 4 ILE A 102 ? GLU A 105 ? ILE A 195 GLU A 198 B 1 THR A 32 ? SER A 34 ? THR A 125 SER A 127 B 2 LYS A 39 ? CYS A 42 ? LYS A 132 CYS A 135 B 3 LEU A 171 ? VAL A 181 ? LEU A 264 VAL A 274 B 4 ILE A 158 ? GLU A 165 ? ILE A 251 GLU A 258 B 5 ARG A 63 ? ILE A 69 ? ARG A 156 ILE A 162 B 6 SER A 122 ? PRO A 126 ? SER A 215 PRO A 219 B 7 GLU A 111 ? TYR A 112 ? GLU A 204 TYR A 205 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 17 ? N ARG A 110 O TRP A 53 ? O TRP A 146 A 2 3 N LEU A 52 ? N LEU A 145 O THR A 137 ? O THR A 230 A 3 4 O ASN A 142 ? O ASN A 235 N ARG A 103 ? N ARG A 196 B 1 2 N SER A 34 ? N SER A 127 O LYS A 39 ? O LYS A 132 B 2 3 N CYS A 42 ? N CYS A 135 O ARG A 180 ? O ARG A 273 B 3 4 O LEU A 172 ? O LEU A 265 N LEU A 164 ? N LEU A 257 B 4 5 O GLU A 165 ? O GLU A 258 N ARG A 63 ? N ARG A 156 B 5 6 N ALA A 66 ? N ALA A 159 O VAL A 123 ? O VAL A 216 B 6 7 O VAL A 124 ? O VAL A 217 N GLU A 111 ? N GLU A 204 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 1 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 1' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 83 ? CYS A 176 . ? 1_555 ? 2 AC1 4 HIS A 86 ? HIS A 179 . ? 1_555 ? 3 AC1 4 CYS A 145 ? CYS A 238 . ? 1_555 ? 4 AC1 4 CYS A 149 ? CYS A 242 . ? 1_555 ? # _database_PDB_matrix.entry_id 2FEJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2FEJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 94 94 SER SER A . n A 1 2 SER 2 95 95 SER SER A . n A 1 3 SER 3 96 96 SER SER A . n A 1 4 VAL 4 97 97 VAL VAL A . n A 1 5 PRO 5 98 98 PRO PRO A . n A 1 6 SER 6 99 99 SER SER A . n A 1 7 GLN 7 100 100 GLN GLN A . n A 1 8 LYS 8 101 101 LYS LYS A . n A 1 9 THR 9 102 102 THR THR A . n A 1 10 TYR 10 103 103 TYR TYR A . n A 1 11 GLN 11 104 104 GLN GLN A . n A 1 12 GLY 12 105 105 GLY GLY A . n A 1 13 SER 13 106 106 SER SER A . n A 1 14 TYR 14 107 107 TYR TYR A . n A 1 15 GLY 15 108 108 GLY GLY A . n A 1 16 PHE 16 109 109 PHE PHE A . n A 1 17 ARG 17 110 110 ARG ARG A . n A 1 18 LEU 18 111 111 LEU LEU A . n A 1 19 GLY 19 112 112 GLY GLY A . n A 1 20 PHE 20 113 113 PHE PHE A . n A 1 21 LEU 21 114 114 LEU LEU A . n A 1 22 HIS 22 115 115 HIS HIS A . n A 1 23 SER 23 116 116 SER SER A . n A 1 24 GLY 24 117 117 GLY GLY A . n A 1 25 THR 25 118 118 THR THR A . n A 1 26 ALA 26 119 119 ALA ALA A . n A 1 27 LYS 27 120 120 LYS LYS A . n A 1 28 SER 28 121 121 SER SER A . n A 1 29 VAL 29 122 122 VAL VAL A . n A 1 30 THR 30 123 123 THR THR A . n A 1 31 CYS 31 124 124 CYS CYS A . n A 1 32 THR 32 125 125 THR THR A . n A 1 33 TYR 33 126 126 TYR TYR A . n A 1 34 SER 34 127 127 SER SER A . n A 1 35 PRO 35 128 128 PRO PRO A . n A 1 36 ALA 36 129 129 ALA ALA A . n A 1 37 LEU 37 130 130 LEU LEU A . n A 1 38 ASN 38 131 131 ASN ASN A . n A 1 39 LYS 39 132 132 LYS LYS A . n A 1 40 MET 40 133 133 MET MET A . n A 1 41 PHE 41 134 134 PHE PHE A . n A 1 42 CYS 42 135 135 CYS CYS A . n A 1 43 GLN 43 136 136 GLN GLN A . n A 1 44 LEU 44 137 137 LEU LEU A . n A 1 45 ALA 45 138 138 ALA ALA A . n A 1 46 LYS 46 139 139 LYS LYS A . n A 1 47 THR 47 140 140 THR THR A . n A 1 48 CYS 48 141 141 CYS CYS A . n A 1 49 PRO 49 142 142 PRO PRO A . n A 1 50 VAL 50 143 143 VAL VAL A . n A 1 51 GLN 51 144 144 GLN GLN A . n A 1 52 LEU 52 145 145 LEU LEU A . n A 1 53 TRP 53 146 146 TRP TRP A . n A 1 54 VAL 54 147 147 VAL VAL A . n A 1 55 ASP 55 148 148 ASP ASP A . n A 1 56 SER 56 149 149 SER SER A . n A 1 57 THR 57 150 150 THR THR A . n A 1 58 PRO 58 151 151 PRO PRO A . n A 1 59 PRO 59 152 152 PRO PRO A . n A 1 60 PRO 60 153 153 PRO PRO A . n A 1 61 GLY 61 154 154 GLY GLY A . n A 1 62 THR 62 155 155 THR THR A . n A 1 63 ARG 63 156 156 ARG ARG A . n A 1 64 VAL 64 157 157 VAL VAL A . n A 1 65 ARG 65 158 158 ARG ARG A . n A 1 66 ALA 66 159 159 ALA ALA A . n A 1 67 MET 67 160 160 MET MET A . n A 1 68 ALA 68 161 161 ALA ALA A . n A 1 69 ILE 69 162 162 ILE ILE A . n A 1 70 TYR 70 163 163 TYR TYR A . n A 1 71 LYS 71 164 164 LYS LYS A . n A 1 72 GLN 72 165 165 GLN GLN A . n A 1 73 SER 73 166 166 SER SER A . n A 1 74 GLN 74 167 167 GLN GLN A . n A 1 75 HIS 75 168 168 HIS HIS A . n A 1 76 MET 76 169 169 MET MET A . n A 1 77 THR 77 170 170 THR THR A . n A 1 78 GLU 78 171 171 GLU GLU A . n A 1 79 VAL 79 172 172 VAL VAL A . n A 1 80 VAL 80 173 173 VAL VAL A . n A 1 81 ARG 81 174 174 ARG ARG A . n A 1 82 ARG 82 175 175 ARG ARG A . n A 1 83 CYS 83 176 176 CYS CYS A . n A 1 84 PRO 84 177 177 PRO PRO A . n A 1 85 HIS 85 178 178 HIS HIS A . n A 1 86 HIS 86 179 179 HIS HIS A . n A 1 87 GLU 87 180 180 GLU GLU A . n A 1 88 ARG 88 181 181 ARG ARG A . n A 1 89 CYS 89 182 182 CYS CYS A . n A 1 90 SER 90 183 183 SER SER A . n A 1 91 ASP 91 184 184 ASP ASP A . n A 1 92 SER 92 185 185 SER SER A . n A 1 93 ASP 93 186 186 ASP ASP A . n A 1 94 GLY 94 187 187 GLY GLY A . n A 1 95 LEU 95 188 188 LEU LEU A . n A 1 96 ALA 96 189 189 ALA ALA A . n A 1 97 PRO 97 190 190 PRO PRO A . n A 1 98 PRO 98 191 191 PRO PRO A . n A 1 99 GLN 99 192 192 GLN GLN A . n A 1 100 HIS 100 193 193 HIS HIS A . n A 1 101 LEU 101 194 194 LEU LEU A . n A 1 102 ILE 102 195 195 ILE ILE A . n A 1 103 ARG 103 196 196 ARG ARG A . n A 1 104 VAL 104 197 197 VAL VAL A . n A 1 105 GLU 105 198 198 GLU GLU A . n A 1 106 GLY 106 199 199 GLY GLY A . n A 1 107 ASN 107 200 200 ASN ASN A . n A 1 108 LEU 108 201 201 LEU LEU A . n A 1 109 ARG 109 202 202 ARG ARG A . n A 1 110 VAL 110 203 203 VAL VAL A . n A 1 111 GLU 111 204 204 GLU GLU A . n A 1 112 TYR 112 205 205 TYR TYR A . n A 1 113 LEU 113 206 206 LEU LEU A . n A 1 114 ASP 114 207 207 ASP ASP A . n A 1 115 ASP 115 208 208 ASP ASP A . n A 1 116 ARG 116 209 209 ARG ARG A . n A 1 117 ASN 117 210 210 ASN ASN A . n A 1 118 THR 118 211 211 THR THR A . n A 1 119 PHE 119 212 212 PHE PHE A . n A 1 120 ARG 120 213 213 ARG ARG A . n A 1 121 HIS 121 214 214 HIS HIS A . n A 1 122 SER 122 215 215 SER SER A . n A 1 123 VAL 123 216 216 VAL VAL A . n A 1 124 VAL 124 217 217 VAL VAL A . n A 1 125 VAL 125 218 218 VAL VAL A . n A 1 126 PRO 126 219 219 PRO PRO A . n A 1 127 TYR 127 220 220 TYR TYR A . n A 1 128 GLU 128 221 221 GLU GLU A . n A 1 129 PRO 129 222 222 PRO PRO A . n A 1 130 PRO 130 223 223 PRO PRO A . n A 1 131 GLU 131 224 224 GLU GLU A . n A 1 132 VAL 132 225 225 VAL VAL A . n A 1 133 GLY 133 226 226 GLY GLY A . n A 1 134 SER 134 227 227 SER SER A . n A 1 135 ASP 135 228 228 ASP ASP A . n A 1 136 CYS 136 229 229 CYS CYS A . n A 1 137 THR 137 230 230 THR THR A . n A 1 138 THR 138 231 231 THR THR A . n A 1 139 ILE 139 232 232 ILE ILE A . n A 1 140 HIS 140 233 233 HIS HIS A . n A 1 141 TYR 141 234 234 TYR TYR A . n A 1 142 ASN 142 235 235 ASN ASN A . n A 1 143 TYR 143 236 236 TYR TYR A . n A 1 144 MET 144 237 237 MET MET A . n A 1 145 CYS 145 238 238 CYS CYS A . n A 1 146 ASN 146 239 239 ASN ASN A . n A 1 147 SER 147 240 240 SER SER A . n A 1 148 SER 148 241 241 SER SER A . n A 1 149 CYS 149 242 242 CYS CYS A . n A 1 150 MET 150 243 243 MET MET A . n A 1 151 GLY 151 244 244 GLY GLY A . n A 1 152 GLY 152 245 245 GLY GLY A . n A 1 153 MET 153 246 246 MET MET A . n A 1 154 ASN 154 247 247 ASN ASN A . n A 1 155 ARG 155 248 248 ARG ARG A . n A 1 156 ARG 156 249 249 ARG ARG A . n A 1 157 PRO 157 250 250 PRO PRO A . n A 1 158 ILE 158 251 251 ILE ILE A . n A 1 159 LEU 159 252 252 LEU LEU A . n A 1 160 THR 160 253 253 THR THR A . n A 1 161 ILE 161 254 254 ILE ILE A . n A 1 162 ILE 162 255 255 ILE ILE A . n A 1 163 THR 163 256 256 THR THR A . n A 1 164 LEU 164 257 257 LEU LEU A . n A 1 165 GLU 165 258 258 GLU GLU A . n A 1 166 ASP 166 259 259 ASP ASP A . n A 1 167 SER 167 260 260 SER SER A . n A 1 168 SER 168 261 261 SER SER A . n A 1 169 GLY 169 262 262 GLY GLY A . n A 1 170 ASN 170 263 263 ASN ASN A . n A 1 171 LEU 171 264 264 LEU LEU A . n A 1 172 LEU 172 265 265 LEU LEU A . n A 1 173 GLY 173 266 266 GLY GLY A . n A 1 174 ARG 174 267 267 ARG ARG A . n A 1 175 ASN 175 268 268 ASN ASN A . n A 1 176 SER 176 269 269 SER SER A . n A 1 177 PHE 177 270 270 PHE PHE A . n A 1 178 GLU 178 271 271 GLU GLU A . n A 1 179 VAL 179 272 272 VAL VAL A . n A 1 180 ARG 180 273 273 ARG ARG A . n A 1 181 VAL 181 274 274 VAL VAL A . n A 1 182 CYS 182 275 275 CYS CYS A . n A 1 183 ALA 183 276 276 ALA ALA A . n A 1 184 CYS 184 277 277 CYS CYS A . n A 1 185 PRO 185 278 278 PRO PRO A . n A 1 186 GLY 186 279 279 GLY GLY A . n A 1 187 ARG 187 280 280 ARG ARG A . n A 1 188 ASP 188 281 281 ASP ASP A . n A 1 189 ARG 189 282 282 ARG ARG A . n A 1 190 ARG 190 283 283 ARG ARG A . n A 1 191 THR 191 284 284 THR THR A . n A 1 192 GLU 192 285 285 GLU GLU A . n A 1 193 GLU 193 286 286 GLU GLU A . n A 1 194 GLU 194 287 287 GLU GLU A . n A 1 195 ASN 195 288 288 ASN ASN A . n A 1 196 LEU 196 289 289 LEU LEU A . n A 1 197 ARG 197 290 290 ARG ARG A . n A 1 198 LYS 198 291 291 LYS LYS A . n A 1 199 LYS 199 292 292 LYS LYS A . n A 1 200 GLY 200 293 293 GLY GLY A . n A 1 201 GLU 201 294 294 GLU GLU A . n A 1 202 PRO 202 295 295 PRO PRO A . n A 1 203 HIS 203 296 296 HIS HIS A . n A 1 204 HIS 204 297 297 HIS HIS A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 1 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 83 ? A CYS 176 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 ND1 ? A HIS 86 ? A HIS 179 ? 1_555 115.8 ? 2 SG ? A CYS 83 ? A CYS 176 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 145 ? A CYS 238 ? 1_555 131.0 ? 3 ND1 ? A HIS 86 ? A HIS 179 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 145 ? A CYS 238 ? 1_555 96.8 ? 4 SG ? A CYS 83 ? A CYS 176 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 149 ? A CYS 242 ? 1_555 96.1 ? 5 ND1 ? A HIS 86 ? A HIS 179 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 149 ? A CYS 242 ? 1_555 106.9 ? 6 SG ? A CYS 145 ? A CYS 238 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 149 ? A CYS 242 ? 1_555 108.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-01-31 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_spectrometer 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PRO 152 ? ? HG1 A THR 155 ? ? 1.59 2 8 HB2 A PRO 151 ? ? HE2 A TYR 220 ? ? 1.33 3 14 O A GLU 224 ? ? H A SER 227 ? ? 1.54 4 19 O A GLU 224 ? ? H A SER 227 ? ? 1.46 5 23 O A GLU 224 ? ? H A SER 227 ? ? 1.50 6 24 O A GLU 224 ? ? H A SER 227 ? ? 1.59 7 33 O A PRO 152 ? ? HG1 A THR 155 ? ? 1.55 8 36 O A PRO 152 ? ? HG1 A THR 155 ? ? 1.53 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 96 ? ? -67.11 -70.92 2 1 TYR A 103 ? ? -80.68 -80.25 3 1 LYS A 120 ? ? -175.73 -36.00 4 1 SER A 121 ? ? -163.54 109.42 5 1 THR A 123 ? ? -79.02 -72.49 6 1 PRO A 152 ? ? -36.66 128.84 7 1 GLN A 165 ? ? -61.36 97.36 8 1 HIS A 168 ? ? -147.76 28.18 9 1 ASP A 184 ? ? -121.07 -52.05 10 1 ASP A 186 ? ? -136.73 -77.58 11 1 LEU A 188 ? ? 78.49 -3.31 12 1 LEU A 201 ? ? -122.97 -55.12 13 1 ASP A 207 ? ? -177.88 64.06 14 1 PRO A 222 ? ? -35.61 140.84 15 1 VAL A 225 ? ? -53.77 94.26 16 1 MET A 237 ? ? -99.78 43.98 17 1 CYS A 238 ? ? -172.61 115.04 18 1 CYS A 242 ? ? -56.96 88.80 19 1 ASN A 247 ? ? 71.44 52.18 20 1 CYS A 275 ? ? -165.52 30.67 21 1 ALA A 276 ? ? 49.92 24.02 22 1 CYS A 277 ? ? -152.55 72.19 23 1 LYS A 292 ? ? 56.17 72.64 24 1 GLU A 294 ? ? -174.35 -63.33 25 1 PRO A 295 ? ? -67.10 -87.37 26 1 HIS A 296 ? ? 56.91 166.48 27 2 SER A 99 ? ? -58.03 172.83 28 2 SER A 116 ? ? -178.87 -161.08 29 2 SER A 121 ? ? 175.40 93.24 30 2 SER A 149 ? ? -118.81 -148.23 31 2 PRO A 152 ? ? -34.62 119.09 32 2 PRO A 153 ? ? -60.25 90.36 33 2 CYS A 182 ? ? -40.73 152.58 34 2 ASP A 184 ? ? 49.39 -174.90 35 2 SER A 185 ? ? -67.77 -177.04 36 2 LEU A 188 ? ? -162.33 -47.43 37 2 LEU A 201 ? ? -154.60 26.50 38 2 ARG A 202 ? ? -177.69 35.94 39 2 PRO A 222 ? ? -35.19 156.46 40 2 VAL A 225 ? ? -56.66 93.70 41 2 MET A 237 ? ? -112.65 50.83 42 2 CYS A 238 ? ? -164.18 111.15 43 2 CYS A 242 ? ? -51.93 93.43 44 2 CYS A 275 ? ? -161.26 34.54 45 2 CYS A 277 ? ? -174.80 72.59 46 2 PRO A 295 ? ? -54.86 -170.11 47 3 SER A 95 ? ? -163.17 -74.48 48 3 SER A 96 ? ? 60.95 -175.24 49 3 PRO A 98 ? ? -54.32 -170.80 50 3 GLN A 104 ? ? 70.32 -63.98 51 3 SER A 116 ? ? -137.69 -48.12 52 3 SER A 121 ? ? 177.93 70.65 53 3 LYS A 139 ? ? -66.14 -175.15 54 3 CYS A 141 ? ? -108.19 72.65 55 3 SER A 149 ? ? -101.83 -162.91 56 3 PRO A 152 ? ? -35.67 141.87 57 3 PRO A 153 ? ? -77.47 43.92 58 3 HIS A 168 ? ? 178.97 42.29 59 3 SER A 183 ? ? 57.69 -169.15 60 3 ASP A 186 ? ? -176.72 -39.92 61 3 LEU A 201 ? ? -149.43 -43.89 62 3 ARG A 202 ? ? -154.71 52.15 63 3 ASP A 207 ? ? -177.53 82.05 64 3 PRO A 222 ? ? -34.58 108.75 65 3 SER A 227 ? ? -127.35 -51.17 66 3 CYS A 238 ? ? -177.63 107.03 67 3 CYS A 275 ? ? -164.00 27.46 68 3 ALA A 276 ? ? 75.30 -50.76 69 3 LYS A 292 ? ? -168.87 -70.58 70 3 HIS A 296 ? ? 60.35 90.93 71 4 SER A 95 ? ? -150.24 44.33 72 4 SER A 96 ? ? 61.91 115.01 73 4 PRO A 98 ? ? -62.24 -168.95 74 4 GLN A 100 ? ? -97.37 49.12 75 4 TYR A 103 ? ? -58.84 -90.41 76 4 LYS A 120 ? ? 174.92 -36.85 77 4 SER A 121 ? ? -172.19 72.10 78 4 VAL A 122 ? ? -61.93 -167.55 79 4 ALA A 138 ? ? 89.42 -11.87 80 4 PRO A 152 ? ? -38.35 134.98 81 4 GLN A 165 ? ? -67.03 95.13 82 4 HIS A 168 ? ? -153.49 23.31 83 4 SER A 185 ? ? -81.38 -76.67 84 4 ASP A 186 ? ? -143.36 -47.93 85 4 ARG A 202 ? ? -177.55 61.13 86 4 PRO A 222 ? ? -38.83 150.54 87 4 VAL A 225 ? ? -55.74 95.09 88 4 MET A 237 ? ? -117.71 53.12 89 4 CYS A 238 ? ? -176.86 116.63 90 4 CYS A 242 ? ? -56.46 89.69 91 4 ASN A 247 ? ? 62.01 61.42 92 4 CYS A 275 ? ? -167.22 40.36 93 4 CYS A 277 ? ? -160.32 66.58 94 4 GLU A 294 ? ? 60.38 80.21 95 5 SER A 95 ? ? 60.63 100.33 96 5 SER A 96 ? ? -144.09 -58.39 97 5 PRO A 98 ? ? -74.74 -168.91 98 5 GLN A 100 ? ? 66.80 76.85 99 5 GLN A 104 ? ? 170.23 41.59 100 5 LYS A 120 ? ? -174.52 -39.81 101 5 SER A 121 ? ? -176.91 62.66 102 5 VAL A 122 ? ? -57.25 -178.98 103 5 THR A 123 ? ? -84.61 -87.42 104 5 ALA A 138 ? ? 80.20 -4.61 105 5 SER A 149 ? ? -115.24 -162.12 106 5 PRO A 152 ? ? -37.66 127.03 107 5 PRO A 153 ? ? -65.63 63.32 108 5 GLN A 165 ? ? -63.48 97.95 109 5 HIS A 168 ? ? -147.71 25.85 110 5 CYS A 182 ? ? -65.00 -169.60 111 5 ASP A 184 ? ? -88.13 -75.23 112 5 SER A 185 ? ? -68.75 96.29 113 5 LEU A 188 ? ? -166.92 -42.44 114 5 LEU A 201 ? ? -144.42 16.21 115 5 ARG A 202 ? ? -151.85 33.11 116 5 PRO A 222 ? ? -35.83 149.20 117 5 VAL A 225 ? ? -58.54 96.96 118 5 CYS A 238 ? ? 179.38 109.14 119 5 CYS A 242 ? ? -53.67 92.64 120 5 ASN A 247 ? ? 62.95 66.68 121 5 LEU A 264 ? ? -59.68 109.57 122 5 CYS A 275 ? ? -161.74 35.64 123 5 ALA A 276 ? ? 68.37 -61.95 124 5 CYS A 277 ? ? -105.64 75.56 125 5 GLU A 294 ? ? 58.70 103.90 126 6 SER A 96 ? ? 60.05 102.14 127 6 VAL A 97 ? ? -58.87 109.79 128 6 PRO A 98 ? ? -70.35 -166.99 129 6 SER A 99 ? ? 65.94 125.17 130 6 GLN A 100 ? ? -177.81 -40.60 131 6 GLN A 104 ? ? -92.87 50.03 132 6 SER A 116 ? ? 165.59 99.94 133 6 LYS A 120 ? ? -50.79 98.29 134 6 SER A 121 ? ? 54.93 73.92 135 6 PRO A 152 ? ? -39.34 115.69 136 6 HIS A 168 ? ? -152.77 26.05 137 6 LEU A 188 ? ? -161.03 -48.88 138 6 LEU A 201 ? ? -126.28 -50.72 139 6 PRO A 222 ? ? -39.36 -178.76 140 6 VAL A 225 ? ? 39.26 80.75 141 6 SER A 227 ? ? 61.19 114.09 142 6 ASP A 228 ? ? -173.39 -63.49 143 6 MET A 237 ? ? -119.12 53.54 144 6 CYS A 238 ? ? -171.75 114.29 145 6 CYS A 242 ? ? -48.78 99.92 146 6 ASN A 247 ? ? 72.38 43.07 147 6 PRO A 250 ? ? -49.74 157.37 148 6 CYS A 275 ? ? -168.50 39.22 149 6 ALA A 276 ? ? 67.47 -64.36 150 6 LYS A 292 ? ? 69.19 -68.71 151 7 SER A 96 ? ? -131.96 -72.72 152 7 GLN A 104 ? ? 36.44 47.48 153 7 LYS A 120 ? ? 163.10 -32.16 154 7 SER A 121 ? ? -165.76 91.59 155 7 VAL A 122 ? ? -88.75 -156.30 156 7 ALA A 138 ? ? 82.13 4.54 157 7 SER A 149 ? ? -117.83 -158.34 158 7 PRO A 152 ? ? -36.15 112.50 159 7 PRO A 153 ? ? -55.49 89.47 160 7 HIS A 168 ? ? -156.41 31.70 161 7 ASP A 184 ? ? -177.26 81.32 162 7 SER A 185 ? ? 62.39 118.76 163 7 LEU A 188 ? ? -155.83 -45.33 164 7 LEU A 201 ? ? -146.66 14.65 165 7 ARG A 202 ? ? 168.87 49.44 166 7 ASP A 207 ? ? -178.25 61.33 167 7 PRO A 222 ? ? -32.80 163.43 168 7 VAL A 225 ? ? 26.23 91.71 169 7 SER A 227 ? ? 62.32 106.98 170 7 ASP A 228 ? ? -158.18 -61.13 171 7 CYS A 238 ? ? 179.40 119.13 172 7 CYS A 242 ? ? -48.61 94.98 173 7 ASN A 247 ? ? 75.41 45.60 174 7 CYS A 275 ? ? -166.73 36.86 175 7 CYS A 277 ? ? -164.44 74.75 176 7 GLU A 294 ? ? -179.91 -60.86 177 8 SER A 96 ? ? -166.38 -44.65 178 8 GLN A 100 ? ? -175.13 -42.14 179 8 GLN A 104 ? ? -161.22 55.69 180 8 SER A 116 ? ? -122.50 -67.48 181 8 SER A 121 ? ? 179.56 82.82 182 8 ALA A 138 ? ? 84.31 0.58 183 8 PRO A 152 ? ? -38.71 122.93 184 8 PRO A 153 ? ? -61.21 95.92 185 8 GLN A 165 ? ? -62.26 94.67 186 8 HIS A 168 ? ? -152.27 30.13 187 8 SER A 183 ? ? 60.49 -165.93 188 8 LEU A 188 ? ? -162.11 37.73 189 8 LEU A 201 ? ? -139.96 -37.37 190 8 ARG A 202 ? ? -118.48 59.70 191 8 ASP A 207 ? ? -175.41 90.18 192 8 PRO A 222 ? ? -34.37 172.16 193 8 VAL A 225 ? ? 27.46 92.49 194 8 SER A 227 ? ? 60.66 113.22 195 8 ASP A 228 ? ? 178.37 -53.86 196 8 CYS A 238 ? ? -174.74 116.88 197 8 CYS A 242 ? ? 44.47 -166.10 198 8 MET A 243 ? ? -137.01 -46.20 199 8 ARG A 248 ? ? 70.18 31.08 200 8 CYS A 275 ? ? -162.79 38.73 201 8 ALA A 276 ? ? 69.52 -53.30 202 8 LYS A 292 ? ? -176.39 105.21 203 8 PRO A 295 ? ? -69.12 -168.70 204 9 SER A 95 ? ? -92.31 -70.05 205 9 SER A 96 ? ? 60.62 98.65 206 9 GLN A 100 ? ? -110.43 61.77 207 9 GLN A 104 ? ? -159.84 49.46 208 9 SER A 116 ? ? 173.40 172.62 209 9 SER A 121 ? ? -165.66 75.78 210 9 THR A 123 ? ? -123.15 -91.86 211 9 ALA A 138 ? ? 94.08 -10.33 212 9 CYS A 141 ? ? -118.50 75.15 213 9 SER A 149 ? ? -104.98 -165.36 214 9 GLN A 165 ? ? -45.03 99.38 215 9 HIS A 168 ? ? -154.13 23.73 216 9 ASP A 186 ? ? -142.90 -68.31 217 9 LEU A 188 ? ? -166.78 -43.06 218 9 PRO A 190 ? ? -56.04 172.25 219 9 ARG A 202 ? ? -167.21 76.34 220 9 PRO A 222 ? ? -36.88 145.80 221 9 VAL A 225 ? ? -52.27 94.69 222 9 CYS A 238 ? ? 178.94 118.07 223 9 CYS A 275 ? ? -159.33 30.41 224 9 ALA A 276 ? ? 68.04 -62.64 225 9 GLU A 294 ? ? -173.86 -62.99 226 10 PRO A 98 ? ? -55.91 -164.39 227 10 GLN A 104 ? ? -177.59 39.09 228 10 SER A 116 ? ? -146.76 -46.26 229 10 SER A 121 ? ? -176.25 78.78 230 10 VAL A 122 ? ? 177.36 154.55 231 10 CYS A 141 ? ? -117.80 79.83 232 10 SER A 149 ? ? -113.58 -164.43 233 10 PRO A 152 ? ? -36.71 130.64 234 10 PRO A 153 ? ? -68.87 61.37 235 10 GLN A 165 ? ? -53.42 104.56 236 10 HIS A 168 ? ? -146.26 32.29 237 10 ASP A 184 ? ? -174.99 40.77 238 10 LEU A 188 ? ? -58.79 -70.13 239 10 LEU A 201 ? ? -140.34 -41.57 240 10 ASP A 207 ? ? -178.57 80.86 241 10 PRO A 222 ? ? -37.82 152.81 242 10 VAL A 225 ? ? -56.35 102.51 243 10 CYS A 238 ? ? -173.92 114.86 244 10 CYS A 242 ? ? -45.12 102.66 245 10 CYS A 275 ? ? -162.23 27.83 246 10 ALA A 276 ? ? 52.16 17.82 247 10 CYS A 277 ? ? -155.08 76.89 248 10 LYS A 292 ? ? 167.93 103.40 249 11 TYR A 103 ? ? -62.90 -75.49 250 11 GLN A 104 ? ? 40.14 79.28 251 11 SER A 116 ? ? -117.72 -71.19 252 11 LYS A 120 ? ? -64.54 80.21 253 11 SER A 121 ? ? 75.25 82.81 254 11 THR A 123 ? ? -130.20 -41.51 255 11 SER A 149 ? ? -103.96 -169.24 256 11 PRO A 152 ? ? -36.93 126.33 257 11 PRO A 153 ? ? -65.54 62.86 258 11 HIS A 168 ? ? -156.16 41.64 259 11 LEU A 188 ? ? -166.32 -43.23 260 11 ARG A 202 ? ? 174.16 43.91 261 11 ASP A 207 ? ? -179.50 77.89 262 11 PRO A 222 ? ? -35.79 149.95 263 11 SER A 227 ? ? -135.27 -64.65 264 11 ASP A 228 ? ? 83.14 -13.77 265 11 CYS A 238 ? ? -179.44 112.42 266 11 CYS A 242 ? ? -50.61 108.53 267 11 MET A 243 ? ? -96.16 36.01 268 11 LEU A 264 ? ? -59.57 106.81 269 11 CYS A 275 ? ? -168.38 30.16 270 11 CYS A 277 ? ? -152.49 67.02 271 11 LYS A 292 ? ? -98.71 45.17 272 12 SER A 95 ? ? -159.70 -46.34 273 12 VAL A 97 ? ? -161.73 80.34 274 12 SER A 99 ? ? 61.90 146.99 275 12 GLN A 100 ? ? -177.67 -75.40 276 12 TYR A 103 ? ? -77.28 -80.72 277 12 GLN A 104 ? ? 33.62 52.37 278 12 LYS A 120 ? ? 176.61 -34.87 279 12 SER A 121 ? ? -174.30 72.06 280 12 VAL A 122 ? ? -69.27 -179.15 281 12 THR A 123 ? ? -99.44 -81.83 282 12 SER A 149 ? ? -116.51 -163.35 283 12 PRO A 152 ? ? -36.53 128.86 284 12 PRO A 153 ? ? -67.45 63.60 285 12 HIS A 168 ? ? -151.63 29.64 286 12 GLU A 171 ? ? 77.54 65.72 287 12 ASP A 184 ? ? -106.22 -69.89 288 12 ASP A 186 ? ? -130.19 -49.26 289 12 LEU A 188 ? ? -144.44 -56.72 290 12 ASP A 207 ? ? -164.23 90.62 291 12 VAL A 225 ? ? 28.26 83.37 292 12 SER A 227 ? ? 65.25 118.25 293 12 ASP A 228 ? ? 174.84 -74.36 294 12 CYS A 238 ? ? -176.93 109.92 295 12 MET A 243 ? ? 63.94 141.51 296 12 CYS A 275 ? ? -164.27 28.55 297 12 ALA A 276 ? ? 45.73 27.36 298 12 CYS A 277 ? ? -160.08 65.33 299 12 LYS A 292 ? ? 63.02 103.09 300 12 GLU A 294 ? ? -152.43 87.75 301 12 PRO A 295 ? ? -52.79 176.21 302 12 HIS A 296 ? ? -176.80 -57.42 303 13 SER A 96 ? ? -110.20 -71.02 304 13 PRO A 98 ? ? -51.99 179.74 305 13 TYR A 103 ? ? -59.68 -82.21 306 13 LYS A 120 ? ? 168.65 -30.72 307 13 SER A 121 ? ? -122.38 -82.96 308 13 VAL A 122 ? ? 78.83 159.29 309 13 SER A 149 ? ? -114.22 -159.23 310 13 PRO A 152 ? ? -36.53 130.93 311 13 PRO A 153 ? ? -69.61 91.56 312 13 HIS A 168 ? ? -148.69 30.75 313 13 LEU A 188 ? ? -174.84 -39.30 314 13 ARG A 202 ? ? -151.32 75.59 315 13 ASP A 207 ? ? -176.98 83.08 316 13 PRO A 222 ? ? -35.54 112.23 317 13 SER A 227 ? ? -127.11 -58.04 318 13 CYS A 238 ? ? -167.70 111.85 319 13 CYS A 242 ? ? -50.50 93.91 320 13 ASN A 247 ? ? 72.82 46.16 321 13 LEU A 264 ? ? -59.22 105.43 322 13 CYS A 275 ? ? -167.06 30.17 323 13 ALA A 276 ? ? 47.03 26.96 324 13 CYS A 277 ? ? -154.90 68.09 325 13 LYS A 292 ? ? 69.29 -66.41 326 13 PRO A 295 ? ? -69.13 -162.83 327 13 HIS A 296 ? ? 76.53 121.01 328 14 SER A 95 ? ? -133.83 -50.87 329 14 GLN A 104 ? ? -151.89 53.62 330 14 LYS A 120 ? ? 166.10 -32.27 331 14 ALA A 138 ? ? 78.23 -1.22 332 14 SER A 149 ? ? -178.38 -174.55 333 14 PRO A 152 ? ? -38.52 115.38 334 14 HIS A 168 ? ? -157.07 35.41 335 14 CYS A 182 ? ? -54.20 -76.35 336 14 ASP A 184 ? ? 62.26 93.55 337 14 SER A 185 ? ? 63.46 139.28 338 14 ASP A 186 ? ? -146.68 -50.82 339 14 LEU A 188 ? ? -148.86 -45.59 340 14 LEU A 201 ? ? -132.44 -47.19 341 14 PRO A 222 ? ? -36.40 160.11 342 14 SER A 227 ? ? 70.38 94.00 343 14 ASP A 228 ? ? -151.35 -102.96 344 14 MET A 237 ? ? -114.37 51.48 345 14 CYS A 238 ? ? -173.41 115.22 346 14 CYS A 242 ? ? -55.39 99.20 347 14 ASN A 247 ? ? 67.12 63.13 348 14 CYS A 275 ? ? -164.33 32.66 349 14 ALA A 276 ? ? 45.47 29.13 350 14 CYS A 277 ? ? -157.40 65.65 351 14 LYS A 292 ? ? -131.90 -59.38 352 14 GLU A 294 ? ? -46.62 101.00 353 14 PRO A 295 ? ? -69.10 -158.09 354 15 SER A 99 ? ? -178.61 -176.64 355 15 GLN A 100 ? ? -166.34 31.70 356 15 SER A 116 ? ? -135.58 -46.59 357 15 LYS A 120 ? ? -62.68 84.98 358 15 SER A 121 ? ? 76.39 69.50 359 15 CYS A 141 ? ? -105.55 78.61 360 15 SER A 149 ? ? -115.99 -168.23 361 15 PRO A 152 ? ? -36.56 135.63 362 15 GLN A 165 ? ? -63.53 91.60 363 15 HIS A 168 ? ? -155.36 31.19 364 15 ASP A 184 ? ? -108.93 -67.52 365 15 SER A 185 ? ? -179.45 126.52 366 15 LEU A 188 ? ? -179.48 -53.58 367 15 ARG A 202 ? ? -159.61 76.43 368 15 PRO A 222 ? ? -30.24 163.56 369 15 VAL A 225 ? ? -38.56 94.90 370 15 SER A 227 ? ? 64.87 110.92 371 15 ASP A 228 ? ? -176.41 -69.09 372 15 CYS A 238 ? ? -177.20 113.03 373 15 CYS A 242 ? ? -53.76 97.54 374 15 ASN A 247 ? ? 70.27 57.07 375 15 CYS A 275 ? ? -164.37 29.51 376 15 CYS A 277 ? ? 177.84 74.52 377 15 GLU A 294 ? ? -143.17 54.10 378 15 HIS A 296 ? ? -171.85 106.64 379 16 SER A 95 ? ? 60.87 81.67 380 16 SER A 96 ? ? 60.06 91.80 381 16 SER A 99 ? ? 62.78 124.23 382 16 GLN A 100 ? ? -179.53 -38.16 383 16 GLN A 104 ? ? -147.57 54.41 384 16 SER A 121 ? ? 177.05 80.15 385 16 ALA A 138 ? ? 77.83 -2.94 386 16 SER A 149 ? ? -84.84 -156.62 387 16 PRO A 153 ? ? -40.00 -27.13 388 16 GLN A 165 ? ? -53.87 93.45 389 16 HIS A 168 ? ? -158.73 32.07 390 16 SER A 183 ? ? 63.29 92.81 391 16 LEU A 188 ? ? -156.56 -45.62 392 16 LEU A 201 ? ? -144.87 16.86 393 16 ARG A 202 ? ? -148.11 30.63 394 16 ASP A 207 ? ? -167.65 89.53 395 16 PRO A 222 ? ? -33.27 151.52 396 16 VAL A 225 ? ? -50.85 101.79 397 16 ASP A 228 ? ? 75.13 -3.20 398 16 CYS A 238 ? ? 178.75 111.11 399 16 MET A 243 ? ? 66.09 -74.06 400 16 CYS A 275 ? ? -168.37 33.75 401 16 ALA A 276 ? ? 46.83 27.20 402 16 CYS A 277 ? ? -157.09 73.92 403 16 GLU A 294 ? ? -174.79 66.75 404 16 HIS A 296 ? ? -164.70 -44.66 405 17 TYR A 103 ? ? -112.39 71.46 406 17 LYS A 120 ? ? 178.56 -33.74 407 17 VAL A 122 ? ? -137.36 -156.60 408 17 SER A 149 ? ? -103.88 -167.38 409 17 PRO A 152 ? ? -39.85 121.54 410 17 PRO A 153 ? ? -48.59 -18.03 411 17 GLN A 165 ? ? 70.50 -172.94 412 17 HIS A 168 ? ? -162.70 38.52 413 17 CYS A 182 ? ? -76.83 -165.15 414 17 SER A 185 ? ? -66.58 -168.64 415 17 LEU A 201 ? ? -158.66 22.03 416 17 ARG A 202 ? ? 175.35 47.38 417 17 ASP A 207 ? ? -176.84 81.48 418 17 PRO A 222 ? ? -36.09 149.16 419 17 VAL A 225 ? ? -56.68 98.88 420 17 CYS A 238 ? ? -171.01 113.40 421 17 CYS A 242 ? ? -52.30 98.76 422 17 CYS A 275 ? ? -161.68 33.20 423 17 ALA A 276 ? ? 49.31 26.61 424 17 CYS A 277 ? ? -164.28 70.69 425 17 LYS A 292 ? ? -176.73 115.92 426 17 HIS A 296 ? ? -58.19 90.48 427 18 SER A 95 ? ? -176.53 -46.05 428 18 TYR A 103 ? ? -54.80 -86.47 429 18 GLN A 104 ? ? 37.72 35.28 430 18 LYS A 120 ? ? -171.09 -39.68 431 18 THR A 123 ? ? -103.58 -103.38 432 18 SER A 149 ? ? -108.83 -165.59 433 18 PRO A 152 ? ? -34.46 126.87 434 18 PRO A 153 ? ? -65.76 65.16 435 18 HIS A 168 ? ? -172.80 51.61 436 18 GLU A 171 ? ? -89.28 -142.29 437 18 ASP A 186 ? ? -154.50 -58.67 438 18 LEU A 188 ? ? 81.66 -41.33 439 18 LEU A 201 ? ? -155.70 -42.93 440 18 ARG A 202 ? ? -145.02 53.14 441 18 ASP A 207 ? ? -178.11 88.69 442 18 PRO A 222 ? ? -35.58 146.16 443 18 VAL A 225 ? ? -57.58 94.27 444 18 ASP A 228 ? ? 78.64 -2.12 445 18 CYS A 238 ? ? 179.70 117.69 446 18 CYS A 242 ? ? -43.80 105.04 447 18 ASN A 247 ? ? 61.60 70.55 448 18 CYS A 275 ? ? -163.06 35.74 449 18 ALA A 276 ? ? 67.99 -61.43 450 18 LYS A 292 ? ? -173.12 -68.78 451 19 SER A 95 ? ? -162.51 46.65 452 19 VAL A 97 ? ? -105.90 77.75 453 19 GLN A 100 ? ? -147.63 -57.82 454 19 TYR A 103 ? ? -66.94 -76.60 455 19 LYS A 120 ? ? 177.67 -36.64 456 19 SER A 149 ? ? -110.30 -166.15 457 19 PRO A 152 ? ? -37.86 119.44 458 19 HIS A 168 ? ? 176.48 55.13 459 19 GLU A 171 ? ? -87.10 -141.50 460 19 SER A 185 ? ? 61.80 115.92 461 19 ASP A 186 ? ? -155.11 -57.05 462 19 ARG A 202 ? ? -164.38 62.74 463 19 PRO A 222 ? ? -27.84 130.52 464 19 SER A 227 ? ? 58.40 79.05 465 19 ASP A 228 ? ? -124.23 -87.47 466 19 CYS A 238 ? ? -178.91 116.73 467 19 CYS A 242 ? ? -47.25 101.85 468 19 CYS A 275 ? ? -166.37 34.12 469 19 ALA A 276 ? ? 68.16 -62.37 470 19 CYS A 277 ? ? -105.73 77.13 471 19 LYS A 292 ? ? 66.92 -68.47 472 19 GLU A 294 ? ? 63.09 140.87 473 19 HIS A 296 ? ? -178.52 127.46 474 20 SER A 95 ? ? 61.46 100.27 475 20 SER A 96 ? ? 58.28 -174.47 476 20 LYS A 120 ? ? -172.19 -38.92 477 20 PRO A 153 ? ? -30.85 -33.03 478 20 HIS A 168 ? ? -157.36 42.09 479 20 SER A 183 ? ? -179.24 102.59 480 20 ASP A 184 ? ? -102.32 -61.99 481 20 ASP A 186 ? ? -137.96 -71.00 482 20 LEU A 201 ? ? -142.09 15.85 483 20 ARG A 202 ? ? 179.07 37.51 484 20 ASP A 207 ? ? -176.39 92.68 485 20 PRO A 222 ? ? -32.22 160.00 486 20 VAL A 225 ? ? 9.15 102.55 487 20 SER A 227 ? ? 59.22 104.30 488 20 ASP A 228 ? ? -169.02 -51.49 489 20 CYS A 238 ? ? -177.11 118.32 490 20 CYS A 242 ? ? -63.65 95.58 491 20 ASN A 247 ? ? 60.32 76.50 492 20 CYS A 275 ? ? -160.49 34.55 493 20 ALA A 276 ? ? 69.23 -61.29 494 20 LYS A 292 ? ? 72.21 115.61 495 21 VAL A 97 ? ? 38.08 51.64 496 21 PRO A 98 ? ? -65.65 73.57 497 21 SER A 99 ? ? -152.65 49.35 498 21 GLN A 104 ? ? 176.34 46.06 499 21 SER A 116 ? ? -131.91 -79.89 500 21 LYS A 120 ? ? -66.51 76.04 501 21 SER A 121 ? ? 68.74 107.58 502 21 THR A 123 ? ? -125.17 -91.47 503 21 ALA A 138 ? ? 85.73 -10.97 504 21 SER A 149 ? ? -87.06 -159.95 505 21 PRO A 153 ? ? -38.80 -28.67 506 21 GLN A 165 ? ? -58.33 100.35 507 21 HIS A 168 ? ? -156.59 36.70 508 21 ASP A 184 ? ? -165.58 107.04 509 21 SER A 185 ? ? 60.65 111.49 510 21 ASP A 186 ? ? -102.32 -74.45 511 21 LEU A 188 ? ? -151.32 -46.42 512 21 LEU A 201 ? ? -125.13 -52.38 513 21 ASP A 207 ? ? -173.91 80.19 514 21 PRO A 222 ? ? -36.53 155.09 515 21 CYS A 238 ? ? -171.47 114.69 516 21 CYS A 242 ? ? -51.90 97.56 517 21 CYS A 275 ? ? -165.03 30.63 518 21 ALA A 276 ? ? 44.82 29.68 519 21 CYS A 277 ? ? -160.31 69.77 520 21 LYS A 292 ? ? 178.86 -80.53 521 21 HIS A 296 ? ? 58.15 91.85 522 22 VAL A 97 ? ? 60.45 100.03 523 22 PRO A 98 ? ? -67.72 -171.17 524 22 GLN A 104 ? ? 177.68 40.12 525 22 SER A 116 ? ? -125.94 -65.99 526 22 LYS A 120 ? ? -62.15 83.34 527 22 SER A 121 ? ? 71.62 84.94 528 22 SER A 149 ? ? -77.56 -161.33 529 22 HIS A 168 ? ? -142.17 27.95 530 22 SER A 185 ? ? 60.55 93.99 531 22 ASP A 186 ? ? -122.74 -58.65 532 22 LEU A 188 ? ? 75.31 -59.18 533 22 LEU A 201 ? ? -144.43 -36.69 534 22 ARG A 202 ? ? -107.83 53.99 535 22 ASP A 207 ? ? -177.79 88.25 536 22 PRO A 222 ? ? -35.78 147.64 537 22 VAL A 225 ? ? -55.00 100.37 538 22 CYS A 238 ? ? -175.45 108.84 539 22 CYS A 242 ? ? -49.62 94.65 540 22 CYS A 275 ? ? -166.60 34.77 541 22 ALA A 276 ? ? 45.00 29.71 542 22 CYS A 277 ? ? -168.35 82.72 543 22 LYS A 292 ? ? 59.32 105.22 544 22 HIS A 296 ? ? 62.54 118.96 545 23 SER A 96 ? ? -96.05 -62.35 546 23 PRO A 98 ? ? -52.56 178.66 547 23 GLN A 104 ? ? -156.30 47.13 548 23 SER A 116 ? ? -132.80 -53.94 549 23 SER A 121 ? ? -164.74 43.82 550 23 ALA A 138 ? ? 88.55 -9.93 551 23 SER A 149 ? ? -122.72 -162.11 552 23 PRO A 152 ? ? -34.78 133.24 553 23 PRO A 153 ? ? -69.40 60.82 554 23 HIS A 168 ? ? -156.81 28.67 555 23 ASP A 184 ? ? -149.14 -49.43 556 23 ASP A 186 ? ? -176.56 88.87 557 23 LEU A 188 ? ? -131.92 -49.95 558 23 LEU A 201 ? ? -143.52 -37.46 559 23 PRO A 222 ? ? -31.26 159.52 560 23 VAL A 225 ? ? -39.67 -32.24 561 23 SER A 227 ? ? 63.70 86.28 562 23 ASP A 228 ? ? 177.38 -52.65 563 23 CYS A 238 ? ? -174.87 115.85 564 23 CYS A 242 ? ? -54.70 97.31 565 23 CYS A 275 ? ? -155.66 27.30 566 23 ALA A 276 ? ? 65.98 -62.62 567 24 SER A 96 ? ? -141.48 -55.68 568 24 SER A 99 ? ? 177.78 -34.46 569 24 TYR A 103 ? ? -61.58 -77.41 570 24 SER A 116 ? ? -117.08 -70.80 571 24 SER A 121 ? ? 176.28 86.07 572 24 PRO A 152 ? ? -37.92 139.38 573 24 HIS A 168 ? ? -142.61 32.47 574 24 SER A 183 ? ? 63.52 124.81 575 24 ASP A 184 ? ? -167.07 107.87 576 24 LEU A 188 ? ? -156.19 -42.44 577 24 ARG A 202 ? ? -176.37 54.84 578 24 ASP A 207 ? ? -175.76 94.05 579 24 PRO A 222 ? ? -31.54 148.87 580 24 VAL A 225 ? ? -45.16 92.94 581 24 SER A 227 ? ? 76.64 93.27 582 24 ASP A 228 ? ? -136.36 -97.54 583 24 CYS A 238 ? ? 178.05 118.82 584 24 CYS A 242 ? ? -51.18 93.73 585 24 ASN A 247 ? ? 70.33 54.91 586 24 CYS A 275 ? ? -166.21 40.67 587 24 ALA A 276 ? ? 67.98 -63.33 588 24 LYS A 292 ? ? 62.36 111.57 589 25 GLN A 100 ? ? -162.62 -49.16 590 25 SER A 116 ? ? -133.03 -50.43 591 25 SER A 121 ? ? -178.33 73.98 592 25 SER A 149 ? ? -107.82 -160.93 593 25 PRO A 152 ? ? -33.41 147.31 594 25 HIS A 168 ? ? -158.25 34.20 595 25 ASP A 186 ? ? -118.22 -160.07 596 25 LEU A 188 ? ? 83.67 -37.89 597 25 PRO A 222 ? ? -38.57 162.04 598 25 VAL A 225 ? ? -53.14 104.26 599 25 MET A 237 ? ? -105.72 47.33 600 25 CYS A 238 ? ? -163.24 110.42 601 25 CYS A 242 ? ? 42.00 -161.86 602 25 MET A 243 ? ? -143.06 -46.09 603 25 ASN A 247 ? ? 61.03 67.65 604 25 CYS A 275 ? ? -154.29 23.71 605 25 CYS A 277 ? ? -154.48 80.28 606 25 LYS A 292 ? ? 70.01 97.79 607 25 HIS A 296 ? ? -144.16 -56.42 608 26 SER A 96 ? ? 58.54 162.80 609 26 VAL A 97 ? ? 49.67 159.31 610 26 SER A 99 ? ? 63.61 150.87 611 26 TYR A 103 ? ? -66.48 -88.37 612 26 LYS A 120 ? ? 166.86 -31.17 613 26 SER A 121 ? ? -166.38 63.33 614 26 THR A 123 ? ? -63.56 -80.83 615 26 SER A 149 ? ? -117.09 -164.75 616 26 PRO A 152 ? ? -38.38 111.98 617 26 GLN A 165 ? ? -54.02 94.47 618 26 HIS A 168 ? ? -158.36 34.41 619 26 CYS A 182 ? ? -97.93 30.84 620 26 ASP A 184 ? ? -174.28 -44.94 621 26 ASP A 186 ? ? -144.28 -46.94 622 26 LEU A 188 ? ? 69.08 -59.25 623 26 ARG A 202 ? ? -99.79 34.65 624 26 PRO A 222 ? ? -37.11 135.50 625 26 VAL A 225 ? ? -57.47 97.66 626 26 CYS A 238 ? ? -165.05 111.82 627 26 CYS A 242 ? ? -49.22 93.65 628 26 ASN A 247 ? ? 62.65 71.50 629 26 CYS A 275 ? ? -156.32 30.89 630 26 ALA A 276 ? ? 74.51 -45.10 631 27 SER A 95 ? ? -176.40 -165.46 632 27 VAL A 97 ? ? -178.91 104.88 633 27 PRO A 98 ? ? -51.81 -176.94 634 27 TYR A 103 ? ? -93.11 31.03 635 27 LYS A 120 ? ? 179.65 -38.93 636 27 SER A 121 ? ? -157.07 88.92 637 27 THR A 123 ? ? -60.85 -148.74 638 27 PRO A 152 ? ? -36.82 112.96 639 27 PRO A 153 ? ? -38.16 -27.78 640 27 GLN A 165 ? ? -48.43 95.65 641 27 HIS A 168 ? ? -154.39 32.87 642 27 CYS A 182 ? ? -91.15 -69.22 643 27 ASP A 184 ? ? -158.15 -48.03 644 27 SER A 185 ? ? 67.58 -70.79 645 27 LEU A 188 ? ? 169.03 -33.94 646 27 LEU A 201 ? ? -127.46 -51.51 647 27 VAL A 225 ? ? 33.01 82.01 648 27 SER A 227 ? ? 67.24 125.57 649 27 ASP A 228 ? ? -174.70 -82.67 650 27 CYS A 238 ? ? -172.08 115.45 651 27 MET A 243 ? ? 55.78 102.29 652 27 ASN A 247 ? ? 71.19 68.40 653 27 CYS A 275 ? ? -162.52 32.19 654 27 ALA A 276 ? ? 68.70 -63.38 655 27 LYS A 292 ? ? 69.86 -61.85 656 28 SER A 95 ? ? -161.91 -64.61 657 28 TYR A 103 ? ? -81.65 -83.28 658 28 SER A 121 ? ? 175.96 87.43 659 28 SER A 149 ? ? -86.61 -156.97 660 28 PRO A 153 ? ? -29.59 -33.55 661 28 HIS A 168 ? ? -145.53 31.43 662 28 SER A 185 ? ? 59.80 79.68 663 28 LEU A 188 ? ? -167.39 -44.40 664 28 PRO A 222 ? ? -35.39 148.02 665 28 VAL A 225 ? ? -56.66 101.46 666 28 CYS A 238 ? ? 173.33 120.99 667 28 CYS A 275 ? ? -158.88 27.14 668 28 CYS A 277 ? ? 176.80 106.72 669 28 LYS A 292 ? ? 67.24 -69.05 670 29 SER A 95 ? ? 62.10 148.63 671 29 SER A 96 ? ? -105.69 62.84 672 29 PRO A 98 ? ? -56.88 -160.94 673 29 GLN A 100 ? ? -97.33 35.81 674 29 TYR A 103 ? ? -73.77 -83.60 675 29 GLN A 104 ? ? 39.84 33.04 676 29 SER A 116 ? ? -152.70 -9.77 677 29 LYS A 120 ? ? 160.07 -29.19 678 29 SER A 121 ? ? -130.40 -78.89 679 29 VAL A 122 ? ? 78.47 162.24 680 29 SER A 149 ? ? -114.35 -157.88 681 29 PRO A 152 ? ? -37.00 112.73 682 29 PRO A 153 ? ? -55.36 88.60 683 29 HIS A 168 ? ? -153.55 30.25 684 29 SER A 185 ? ? 62.86 145.43 685 29 ASP A 186 ? ? 177.73 74.06 686 29 LEU A 188 ? ? -142.65 -46.62 687 29 ARG A 202 ? ? -98.07 37.28 688 29 ASP A 207 ? ? -177.83 93.16 689 29 SER A 227 ? ? 47.16 97.33 690 29 ASP A 228 ? ? 172.04 -42.49 691 29 CYS A 238 ? ? -171.51 109.54 692 29 CYS A 242 ? ? -47.13 95.81 693 29 ASN A 247 ? ? 71.59 53.65 694 29 CYS A 275 ? ? -165.43 36.17 695 29 CYS A 277 ? ? -167.28 78.59 696 29 LYS A 292 ? ? -107.91 -72.57 697 29 GLU A 294 ? ? 61.38 91.13 698 29 HIS A 296 ? ? -171.13 34.90 699 30 SER A 95 ? ? 60.85 111.80 700 30 SER A 99 ? ? -152.49 57.77 701 30 GLN A 100 ? ? -148.13 -49.01 702 30 GLN A 104 ? ? -142.77 39.31 703 30 LYS A 120 ? ? 172.35 74.59 704 30 SER A 121 ? ? 77.61 96.73 705 30 ALA A 138 ? ? 76.70 -1.18 706 30 SER A 149 ? ? -84.79 -156.62 707 30 PRO A 153 ? ? -39.97 83.64 708 30 HIS A 168 ? ? -151.77 21.56 709 30 GLU A 171 ? ? -124.73 -148.59 710 30 CYS A 176 ? ? -48.69 155.73 711 30 CYS A 182 ? ? 43.93 -92.24 712 30 SER A 183 ? ? 177.84 -51.71 713 30 SER A 185 ? ? -58.10 172.45 714 30 ASP A 186 ? ? -137.00 -70.12 715 30 LEU A 201 ? ? -141.11 -39.84 716 30 ARG A 202 ? ? -110.75 58.73 717 30 ASP A 207 ? ? -159.35 70.89 718 30 PRO A 222 ? ? -36.80 151.25 719 30 VAL A 225 ? ? -56.59 90.68 720 30 SER A 227 ? ? -108.06 -67.09 721 30 CYS A 238 ? ? -175.29 116.17 722 30 CYS A 242 ? ? -38.86 103.84 723 30 ASN A 247 ? ? 72.38 51.56 724 30 CYS A 275 ? ? -162.55 32.23 725 30 ALA A 276 ? ? 69.37 -56.80 726 30 CYS A 277 ? ? -105.01 75.17 727 31 PRO A 98 ? ? -64.63 91.98 728 31 SER A 99 ? ? -172.26 103.25 729 31 GLN A 100 ? ? -177.30 -39.99 730 31 GLN A 104 ? ? 168.35 43.29 731 31 SER A 116 ? ? -132.36 -59.28 732 31 SER A 121 ? ? 176.09 93.78 733 31 THR A 123 ? ? -136.74 -40.06 734 31 SER A 149 ? ? -92.49 -159.05 735 31 GLN A 165 ? ? -53.91 91.58 736 31 HIS A 168 ? ? -166.77 38.11 737 31 CYS A 182 ? ? 30.89 -92.73 738 31 SER A 183 ? ? 174.95 -37.17 739 31 ASP A 184 ? ? -170.71 -179.06 740 31 ASP A 186 ? ? -134.13 -72.10 741 31 LEU A 201 ? ? -148.18 44.16 742 31 ARG A 202 ? ? 80.44 77.14 743 31 ASP A 207 ? ? -174.10 65.67 744 31 PRO A 222 ? ? -42.25 169.29 745 31 SER A 227 ? ? 62.13 86.82 746 31 ASP A 228 ? ? -177.64 -64.79 747 31 MET A 237 ? ? -115.52 51.77 748 31 CYS A 238 ? ? -164.63 110.76 749 31 CYS A 242 ? ? -49.33 94.93 750 31 ASN A 247 ? ? 73.26 44.60 751 31 CYS A 275 ? ? -159.79 32.09 752 31 ALA A 276 ? ? 45.60 29.85 753 31 CYS A 277 ? ? -175.74 79.88 754 31 LYS A 292 ? ? -175.75 115.63 755 31 GLU A 294 ? ? 59.06 74.05 756 31 HIS A 296 ? ? 62.69 115.06 757 32 SER A 95 ? ? -123.00 -59.63 758 32 VAL A 97 ? ? 177.03 117.94 759 32 SER A 99 ? ? 64.51 156.11 760 32 TYR A 103 ? ? -57.21 -81.73 761 32 SER A 116 ? ? -134.85 -67.48 762 32 SER A 121 ? ? 175.82 106.73 763 32 VAL A 122 ? ? -167.66 -41.90 764 32 THR A 123 ? ? 79.52 -48.05 765 32 SER A 149 ? ? -83.39 -159.52 766 32 PRO A 153 ? ? -29.16 -34.25 767 32 HIS A 168 ? ? -158.43 34.85 768 32 SER A 183 ? ? 64.10 117.28 769 32 ASP A 186 ? ? -132.25 -40.71 770 32 LEU A 188 ? ? 68.49 -1.34 771 32 LEU A 201 ? ? -127.62 -55.10 772 32 ARG A 202 ? ? -157.71 77.87 773 32 ASP A 207 ? ? -173.70 104.95 774 32 VAL A 225 ? ? 42.72 -84.20 775 32 SER A 227 ? ? 49.63 78.77 776 32 ASP A 228 ? ? -178.48 -44.38 777 32 CYS A 238 ? ? -179.21 117.37 778 32 CYS A 242 ? ? -47.13 95.57 779 32 ASN A 247 ? ? 65.09 61.02 780 32 CYS A 275 ? ? -170.13 39.19 781 32 CYS A 277 ? ? -167.38 78.23 782 32 LYS A 292 ? ? -91.24 -80.33 783 33 TYR A 103 ? ? -108.28 68.51 784 33 SER A 116 ? ? 167.43 145.43 785 33 SER A 121 ? ? -179.15 81.17 786 33 SER A 149 ? ? -109.23 -164.54 787 33 PRO A 152 ? ? -36.47 109.16 788 33 PRO A 153 ? ? -38.01 -28.40 789 33 HIS A 168 ? ? -147.27 27.44 790 33 CYS A 182 ? ? -99.75 30.95 791 33 ASP A 184 ? ? -139.48 -63.98 792 33 SER A 185 ? ? -179.54 -76.37 793 33 ASP A 186 ? ? 69.63 -65.66 794 33 LEU A 201 ? ? -141.78 11.78 795 33 VAL A 225 ? ? 44.92 -81.79 796 33 SER A 227 ? ? 56.99 109.80 797 33 ASP A 228 ? ? 175.35 -75.43 798 33 MET A 237 ? ? -146.76 34.50 799 33 ASN A 247 ? ? 62.32 69.52 800 33 CYS A 275 ? ? -170.07 42.17 801 33 ALA A 276 ? ? 68.72 -62.16 802 33 LYS A 292 ? ? -164.72 102.05 803 33 PRO A 295 ? ? -68.85 -167.89 804 34 SER A 99 ? ? 64.04 134.37 805 34 GLN A 100 ? ? -150.07 -73.71 806 34 TYR A 103 ? ? -65.37 -80.33 807 34 GLN A 104 ? ? 39.29 36.25 808 34 LYS A 120 ? ? 174.30 -34.57 809 34 SER A 121 ? ? -165.55 62.57 810 34 THR A 123 ? ? -83.27 -111.48 811 34 ALA A 138 ? ? 91.30 -13.48 812 34 SER A 149 ? ? -85.01 -153.20 813 34 PRO A 153 ? ? -34.31 -29.15 814 34 HIS A 168 ? ? -152.33 12.89 815 34 GLU A 171 ? ? -128.22 -142.60 816 34 ARG A 202 ? ? -94.41 35.49 817 34 ASP A 207 ? ? -174.79 78.03 818 34 PRO A 222 ? ? -33.97 154.14 819 34 VAL A 225 ? ? -51.43 94.50 820 34 ASP A 228 ? ? -143.33 21.66 821 34 MET A 237 ? ? -96.41 41.81 822 34 CYS A 275 ? ? -158.65 34.85 823 34 ALA A 276 ? ? 68.87 -55.17 824 34 CYS A 277 ? ? -105.89 74.55 825 34 PRO A 295 ? ? -57.81 -155.63 826 34 HIS A 296 ? ? 69.53 -65.47 827 35 SER A 96 ? ? 60.18 163.26 828 35 TYR A 103 ? ? -63.19 -75.81 829 35 GLN A 104 ? ? 38.46 34.19 830 35 SER A 116 ? ? -137.95 -79.41 831 35 SER A 121 ? ? 179.12 86.58 832 35 THR A 123 ? ? -134.08 -82.42 833 35 SER A 149 ? ? -92.68 -156.50 834 35 PRO A 153 ? ? -29.91 -32.01 835 35 HIS A 168 ? ? -151.63 29.58 836 35 SER A 183 ? ? 68.42 -68.84 837 35 SER A 185 ? ? 51.88 -167.05 838 35 ASP A 186 ? ? -102.18 -62.97 839 35 LEU A 188 ? ? -139.60 -61.85 840 35 LEU A 201 ? ? -126.67 -51.91 841 35 PRO A 222 ? ? -50.23 -73.11 842 35 VAL A 225 ? ? 39.12 84.90 843 35 SER A 227 ? ? 62.51 112.24 844 35 ASP A 228 ? ? 179.44 -58.07 845 35 CYS A 238 ? ? -178.16 116.71 846 35 ASN A 247 ? ? 62.52 64.97 847 35 LEU A 264 ? ? -59.53 107.19 848 35 CYS A 275 ? ? -163.62 31.35 849 35 ALA A 276 ? ? 47.49 26.14 850 35 CYS A 277 ? ? -158.21 72.31 851 35 LYS A 292 ? ? 68.45 -68.30 852 35 PRO A 295 ? ? -54.49 -171.05 853 36 SER A 95 ? ? -164.19 43.74 854 36 GLN A 100 ? ? -94.73 46.03 855 36 GLN A 104 ? ? -147.76 44.22 856 36 SER A 116 ? ? 174.29 105.46 857 36 SER A 121 ? ? -174.18 66.03 858 36 ALA A 138 ? ? 91.69 -14.26 859 36 LYS A 139 ? ? -55.89 172.53 860 36 SER A 149 ? ? -113.91 -167.53 861 36 PRO A 152 ? ? -37.26 108.20 862 36 PRO A 153 ? ? -36.38 -29.39 863 36 HIS A 168 ? ? 177.74 53.51 864 36 SER A 183 ? ? 61.76 -169.63 865 36 ASP A 184 ? ? -174.09 93.98 866 36 SER A 185 ? ? 61.82 149.66 867 36 ASP A 186 ? ? -141.79 -48.42 868 36 LEU A 188 ? ? -175.25 -27.73 869 36 ARG A 202 ? ? -152.13 76.22 870 36 ASP A 207 ? ? -178.04 82.16 871 36 VAL A 225 ? ? 28.54 83.70 872 36 SER A 227 ? ? 65.03 120.01 873 36 ASP A 228 ? ? 171.76 -71.56 874 36 CYS A 238 ? ? -171.90 114.26 875 36 CYS A 242 ? ? -56.52 100.50 876 36 LEU A 264 ? ? -59.73 100.69 877 36 CYS A 275 ? ? -171.83 32.67 878 36 CYS A 277 ? ? -161.93 77.15 879 36 LYS A 292 ? ? -123.20 -81.33 880 36 GLU A 294 ? ? 62.98 143.99 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #