data_2FQQ # _entry.id 2FQQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2FQQ RCSB RCSB036197 WWPDB D_1000036197 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1sc1 'Crystal structure of an active-site ligand-free form of the human caspase-1 C285A mutant' unspecified PDB 1sc3 'Crystal structure of the human caspase-1 C285A mutant in complex with malonate' unspecified PDB 1sc4 'Crystal structure of the human caspase-1 C285A mutant after removal of malonate' unspecified PDB 2FQR ;Crystal structure of wildtype human caspase-1 in complex with 3-(2-{2-[(cyclohexylmethoxy-hydroxy-methyl)-amino]-1-hydroxy-3-methyl-butylamino}-1-hydroxy-propylamino)-pentane-1,1,4-triol (z-VAD-FMK) ; unspecified PDB 2FQS ;Crystal structure of human caspase-1 (Arg286->Ala) in complex with 3-(2-{2-[(cyclohexylmethoxy-hydroxy-methyl)-amino]-1-hydroxy-3-methyl-butylamino}-1-hydroxy-propylamino)-pentane-1,1,4-triol (z-VAD-FMK) ; unspecified PDB 2FQU ;Crystal structure of human caspase-1 (Glu390->Ala) in complex with 3-(2-{2-[(cyclohexylmethoxy-hydroxy-methyl)-amino]-1-hydroxy-3-methyl-butylamino}-1-hydroxy-propylamino)-pentane-1,1,4-triol (z-VAD-FMK) ; unspecified PDB 2FQV ;Crystal structure of human caspase-1 (Arg286->Ala, Glu390->Ala) in complex with 3-(2-{2-[(cyclohexylmethoxy-hydroxy-methyl)-amino]-1-hydroxy-3-methyl-butylamino}-1-hydroxy-propylamino)-pentane-1,1,4-triol (z-VAD-FMK) ; unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2FQQ _pdbx_database_status.recvd_initial_deposition_date 2006-01-18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Scheer, J.M.' 1 'Wells, J.A.' 2 'Romanowski, M.J.' 3 # _citation.id primary _citation.title 'A common allosteric site and mechanism in caspases' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 103 _citation.page_first 7595 _citation.page_last 7600 _citation.year 2006 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16682620 _citation.pdbx_database_id_DOI 10.1073/pnas.0602571103 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Scheer, J.M.' 1 primary 'Romanowski, M.J.' 2 primary 'Wells, J.A.' 3 # _cell.entry_id 2FQQ _cell.length_a 71.044 _cell.length_b 71.044 _cell.length_c 117.761 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2FQQ _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Caspase-1 19837.773 1 3.4.22.36 C285A 'p20 subunit, residues 120-297' ? 2 polymer man Caspase-1 10162.559 1 3.4.22.36 'C362A, C364A, C397A' 'p10 subunit, residues 317-404' ? 3 non-polymer syn '1-METHYL-3-TRIFLUOROMETHYL-1H-THIENO[2,3-C]PYRAZOLE-5-CARBOXYLIC ACID (2-MERCAPTO-ETHYL)-AMIDE' 309.331 1 ? ? ? ? 4 water nat water 18.015 18 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYS VDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKV IIIQAARGDSPGVVWFKD ; ;NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYS VDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKV IIIQAARGDSPGVVWFKD ; A ? 2 'polypeptide(L)' no no ;AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYAASADVEEIFRKVRFSFEQPDGRAQMPTTERVTLTR AFYLFPGH ; ;AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYAASADVEEIFRKVRFSFEQPDGRAQMPTTERVTLTR AFYLFPGH ; B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 PRO n 1 3 ALA n 1 4 MET n 1 5 PRO n 1 6 THR n 1 7 SER n 1 8 SER n 1 9 GLY n 1 10 SER n 1 11 GLU n 1 12 GLY n 1 13 ASN n 1 14 VAL n 1 15 LYS n 1 16 LEU n 1 17 CYS n 1 18 SER n 1 19 LEU n 1 20 GLU n 1 21 GLU n 1 22 ALA n 1 23 GLN n 1 24 ARG n 1 25 ILE n 1 26 TRP n 1 27 LYS n 1 28 GLN n 1 29 LYS n 1 30 SER n 1 31 ALA n 1 32 GLU n 1 33 ILE n 1 34 TYR n 1 35 PRO n 1 36 ILE n 1 37 MET n 1 38 ASP n 1 39 LYS n 1 40 SER n 1 41 SER n 1 42 ARG n 1 43 THR n 1 44 ARG n 1 45 LEU n 1 46 ALA n 1 47 LEU n 1 48 ILE n 1 49 ILE n 1 50 CYS n 1 51 ASN n 1 52 GLU n 1 53 GLU n 1 54 PHE n 1 55 ASP n 1 56 SER n 1 57 ILE n 1 58 PRO n 1 59 ARG n 1 60 ARG n 1 61 THR n 1 62 GLY n 1 63 ALA n 1 64 GLU n 1 65 VAL n 1 66 ASP n 1 67 ILE n 1 68 THR n 1 69 GLY n 1 70 MET n 1 71 THR n 1 72 MET n 1 73 LEU n 1 74 LEU n 1 75 GLN n 1 76 ASN n 1 77 LEU n 1 78 GLY n 1 79 TYR n 1 80 SER n 1 81 VAL n 1 82 ASP n 1 83 VAL n 1 84 LYS n 1 85 LYS n 1 86 ASN n 1 87 LEU n 1 88 THR n 1 89 ALA n 1 90 SER n 1 91 ASP n 1 92 MET n 1 93 THR n 1 94 THR n 1 95 GLU n 1 96 LEU n 1 97 GLU n 1 98 ALA n 1 99 PHE n 1 100 ALA n 1 101 HIS n 1 102 ARG n 1 103 PRO n 1 104 GLU n 1 105 HIS n 1 106 LYS n 1 107 THR n 1 108 SER n 1 109 ASP n 1 110 SER n 1 111 THR n 1 112 PHE n 1 113 LEU n 1 114 VAL n 1 115 PHE n 1 116 MET n 1 117 SER n 1 118 HIS n 1 119 GLY n 1 120 ILE n 1 121 ARG n 1 122 GLU n 1 123 GLY n 1 124 ILE n 1 125 CYS n 1 126 GLY n 1 127 LYS n 1 128 LYS n 1 129 HIS n 1 130 SER n 1 131 GLU n 1 132 GLN n 1 133 VAL n 1 134 PRO n 1 135 ASP n 1 136 ILE n 1 137 LEU n 1 138 GLN n 1 139 LEU n 1 140 ASN n 1 141 ALA n 1 142 ILE n 1 143 PHE n 1 144 ASN n 1 145 MET n 1 146 LEU n 1 147 ASN n 1 148 THR n 1 149 LYS n 1 150 ASN n 1 151 CYS n 1 152 PRO n 1 153 SER n 1 154 LEU n 1 155 LYS n 1 156 ASP n 1 157 LYS n 1 158 PRO n 1 159 LYS n 1 160 VAL n 1 161 ILE n 1 162 ILE n 1 163 ILE n 1 164 GLN n 1 165 ALA n 1 166 ALA n 1 167 ARG n 1 168 GLY n 1 169 ASP n 1 170 SER n 1 171 PRO n 1 172 GLY n 1 173 VAL n 1 174 VAL n 1 175 TRP n 1 176 PHE n 1 177 LYS n 1 178 ASP n 2 1 ALA n 2 2 ILE n 2 3 LYS n 2 4 LYS n 2 5 ALA n 2 6 HIS n 2 7 ILE n 2 8 GLU n 2 9 LYS n 2 10 ASP n 2 11 PHE n 2 12 ILE n 2 13 ALA n 2 14 PHE n 2 15 CYS n 2 16 SER n 2 17 SER n 2 18 THR n 2 19 PRO n 2 20 ASP n 2 21 ASN n 2 22 VAL n 2 23 SER n 2 24 TRP n 2 25 ARG n 2 26 HIS n 2 27 PRO n 2 28 THR n 2 29 MET n 2 30 GLY n 2 31 SER n 2 32 VAL n 2 33 PHE n 2 34 ILE n 2 35 GLY n 2 36 ARG n 2 37 LEU n 2 38 ILE n 2 39 GLU n 2 40 HIS n 2 41 MET n 2 42 GLN n 2 43 GLU n 2 44 TYR n 2 45 ALA n 2 46 ALA n 2 47 SER n 2 48 ALA n 2 49 ASP n 2 50 VAL n 2 51 GLU n 2 52 GLU n 2 53 ILE n 2 54 PHE n 2 55 ARG n 2 56 LYS n 2 57 VAL n 2 58 ARG n 2 59 PHE n 2 60 SER n 2 61 PHE n 2 62 GLU n 2 63 GLN n 2 64 PRO n 2 65 ASP n 2 66 GLY n 2 67 ARG n 2 68 ALA n 2 69 GLN n 2 70 MET n 2 71 PRO n 2 72 THR n 2 73 THR n 2 74 GLU n 2 75 ARG n 2 76 VAL n 2 77 THR n 2 78 LEU n 2 79 THR n 2 80 ARG n 2 81 ALA n 2 82 PHE n 2 83 TYR n 2 84 LEU n 2 85 PHE n 2 86 PRO n 2 87 GLY n 2 88 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? human Homo 'CASP1, IL1BC, IL1BCE' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 'BL21(DE3)Codon+' ? ? ? ? ? ? ? PLASMID ? ? ? pRSET ? ? 2 1 sample ? ? ? human Homo 'CASP1, IL1BC, IL1BCE' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 'BL21(DE3)Codon+' ? ? ? ? ? ? ? PLASMID ? ? ? pRSET ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code 1 UNP CASP1_HUMAN P29466 1 120 ? ? 2 UNP CASP1_HUMAN P29466 2 317 ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2FQQ A 1 ? 178 ? P29466 120 ? 297 ? 120 297 2 2 2FQQ B 1 ? 88 ? P29466 317 ? 404 ? 317 404 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2FQQ ALA A 166 ? UNP P29466 CYS 285 ENGINEERED 285 1 2 2FQQ ALA B 46 ? UNP P29466 CYS 362 ENGINEERED 362 2 2 2FQQ ALA B 48 ? UNP P29466 CYS 364 ENGINEERED 364 3 2 2FQQ ALA B 81 ? UNP P29466 CYS 397 ENGINEERED 397 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 F1G non-polymer . '1-METHYL-3-TRIFLUOROMETHYL-1H-THIENO[2,3-C]PYRAZOLE-5-CARBOXYLIC ACID (2-MERCAPTO-ETHYL)-AMIDE' ? 'C10 H10 F3 N3 O S2' 309.331 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2FQQ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.86 _exptl_crystal.density_percent_sol 56.97 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '10 mM HEPES, 16.5% PEG 3350, 250 mM (NH4)2SO4, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 110 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 2004-06-03 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Ni FILTER' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH3R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 2FQQ _reflns.observed_criterion_sigma_I 5 _reflns.observed_criterion_sigma_F 1 _reflns.d_resolution_low 20 _reflns.d_resolution_high 3.3 _reflns.number_obs 5490 _reflns.number_all 11608 _reflns.percent_possible_obs 99.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 3.3 _reflns_shell.d_res_low 3.48 _reflns_shell.percent_possible_all 99.8 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2FQQ _refine.ls_number_reflns_obs 5225 _refine.ls_number_reflns_all 5490 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 3.30 _refine.ls_percent_reflns_obs 99.51 _refine.ls_R_factor_obs 0.24542 _refine.ls_R_factor_all 0.24542 _refine.ls_R_factor_R_work 0.2438 _refine.ls_R_factor_R_free 0.28015 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.5 _refine.ls_number_reflns_R_free 247 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.896 _refine.correlation_coeff_Fo_to_Fc_free 0.817 _refine.B_iso_mean 53.207 _refine.aniso_B[1][1] 4.51 _refine.aniso_B[2][2] 4.51 _refine.aniso_B[3][3] -6.77 _refine.aniso_B[1][2] 2.26 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1SC1' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.567 _refine.overall_SU_ML 0.464 _refine.overall_SU_B 62.137 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1861 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 19 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 1898 _refine_hist.d_res_high 3.30 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.006 0.022 ? 1922 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.119 1.966 ? 2596 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 3.259 5.000 ? 233 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 35.744 23.721 ? 86 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 15.756 15.000 ? 340 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 10.942 15.000 ? 13 'X-RAY DIFFRACTION' ? r_chiral_restr 0.042 0.200 ? 286 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.001 0.020 ? 1442 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.123 0.200 ? 813 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.284 0.200 ? 1310 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.086 0.200 ? 66 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.071 0.200 ? 59 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.165 0.200 ? 4 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 15 _refine_ls_shell.d_res_high 3.300 _refine_ls_shell.d_res_low 3.413 _refine_ls_shell.number_reflns_R_work 526 _refine_ls_shell.R_factor_R_work 0.329 _refine_ls_shell.percent_reflns_obs 99.28 _refine_ls_shell.R_factor_R_free 0.268 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 23 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2FQQ _struct.title ;Crystal structure of human caspase-1 (Cys285->Ala, Cys362->Ala, Cys364->Ala, Cys397->Ala) in complex with 1-methyl-3-trifluoromethyl-1H-thieno[2,3-c]pyrazole-5-carboxylic acid (2-mercapto-ethyl)-amide ; _struct.pdbx_descriptor 'Caspase-1 (E.C.3.4.22.36)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2FQQ _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'Caspase, allosteric inhibitor, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # _struct_biol.id 1 _struct_biol.details ;Heterotetramer (dimer of two heterodimers). Each heterodimer is represented by chains A (the p20 subunit) and B (the p10 subunit) of human caspase-1. ; _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 38 ? ARG A 42 ? ASP A 157 ARG A 161 5 ? 5 HELX_P HELX_P2 2 GLY A 62 ? LEU A 77 ? GLY A 181 LEU A 196 1 ? 16 HELX_P HELX_P3 3 THR A 88 ? HIS A 101 ? THR A 207 HIS A 220 1 ? 14 HELX_P HELX_P4 4 ARG A 102 ? SER A 108 ? ARG A 221 SER A 227 5 ? 7 HELX_P HELX_P5 5 LEU A 139 ? ASN A 144 ? LEU A 258 ASN A 263 1 ? 6 HELX_P HELX_P6 6 CYS A 151 ? LYS A 155 ? CYS A 270 LYS A 274 5 ? 5 HELX_P HELX_P7 7 SER B 31 ? TYR B 44 ? SER B 347 TYR B 360 1 ? 14 HELX_P HELX_P8 8 ASP B 49 ? PHE B 61 ? ASP B 365 PHE B 377 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 15 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id C _struct_conn.ptnr2_label_comp_id F1G _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id S1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id B _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 331 _struct_conn.ptnr2_auth_asym_id B _struct_conn.ptnr2_auth_comp_id F1G _struct_conn.ptnr2_auth_seq_id 1 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.814 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 80 ? LYS A 85 ? SER A 199 LYS A 204 A 2 LEU A 45 ? CYS A 50 ? LEU A 164 CYS A 169 A 3 THR A 111 ? HIS A 118 ? THR A 230 HIS A 237 A 4 LYS A 159 ? ALA A 166 ? LYS A 278 ALA A 285 A 5 PHE B 11 ? SER B 16 ? PHE B 327 SER B 332 A 6 PRO B 71 ? GLU B 74 ? PRO B 387 GLU B 390 B 1 GLY A 123 ? CYS A 125 ? GLY A 242 CYS A 244 B 2 ILE A 136 ? GLN A 138 ? ILE A 255 GLN A 257 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ASP A 82 ? O ASP A 201 N ILE A 48 ? N ILE A 167 A 2 3 N ILE A 49 ? N ILE A 168 O VAL A 114 ? O VAL A 233 A 3 4 N LEU A 113 ? N LEU A 232 O VAL A 160 ? O VAL A 279 A 4 5 N ILE A 161 ? N ILE A 280 O ILE B 12 ? O ILE B 328 A 5 6 N ALA B 13 ? N ALA B 329 O GLU B 74 ? O GLU B 390 B 1 2 N ILE A 124 ? N ILE A 243 O LEU A 137 ? O LEU A 256 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 8 _struct_site.details 'BINDING SITE FOR RESIDUE F1G B 1' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 LEU A 139 ? LEU A 258 . ? 6_765 ? 2 AC1 8 LEU A 139 ? LEU A 258 . ? 1_555 ? 3 AC1 8 PHE A 143 ? PHE A 262 . ? 6_765 ? 4 AC1 8 ARG A 167 ? ARG A 286 . ? 1_555 ? 5 AC1 8 CYS B 15 ? CYS B 331 . ? 1_555 ? 6 AC1 8 GLU B 74 ? GLU B 390 . ? 1_555 ? 7 AC1 8 GLU B 74 ? GLU B 390 . ? 6_765 ? 8 AC1 8 ARG B 75 ? ARG B 391 . ? 6_765 ? # _database_PDB_matrix.entry_id 2FQQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2FQQ _atom_sites.fract_transf_matrix[1][1] 0.014076 _atom_sites.fract_transf_matrix[1][2] 0.008127 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016253 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008492 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 120 ? ? ? A . n A 1 2 PRO 2 121 ? ? ? A . n A 1 3 ALA 3 122 ? ? ? A . n A 1 4 MET 4 123 ? ? ? A . n A 1 5 PRO 5 124 ? ? ? A . n A 1 6 THR 6 125 ? ? ? A . n A 1 7 SER 7 126 ? ? ? A . n A 1 8 SER 8 127 ? ? ? A . n A 1 9 GLY 9 128 ? ? ? A . n A 1 10 SER 10 129 ? ? ? A . n A 1 11 GLU 11 130 ? ? ? A . n A 1 12 GLY 12 131 ? ? ? A . n A 1 13 ASN 13 132 ? ? ? A . n A 1 14 VAL 14 133 ? ? ? A . n A 1 15 LYS 15 134 ? ? ? A . n A 1 16 LEU 16 135 ? ? ? A . n A 1 17 CYS 17 136 ? ? ? A . n A 1 18 SER 18 137 ? ? ? A . n A 1 19 LEU 19 138 ? ? ? A . n A 1 20 GLU 20 139 ? ? ? A . n A 1 21 GLU 21 140 ? ? ? A . n A 1 22 ALA 22 141 ? ? ? A . n A 1 23 GLN 23 142 ? ? ? A . n A 1 24 ARG 24 143 ? ? ? A . n A 1 25 ILE 25 144 ? ? ? A . n A 1 26 TRP 26 145 ? ? ? A . n A 1 27 LYS 27 146 ? ? ? A . n A 1 28 GLN 28 147 ? ? ? A . n A 1 29 LYS 29 148 ? ? ? A . n A 1 30 SER 30 149 ? ? ? A . n A 1 31 ALA 31 150 ? ? ? A . n A 1 32 GLU 32 151 151 GLU GLU A . n A 1 33 ILE 33 152 152 ILE ILE A . n A 1 34 TYR 34 153 153 TYR TYR A . n A 1 35 PRO 35 154 154 PRO PRO A . n A 1 36 ILE 36 155 155 ILE ILE A . n A 1 37 MET 37 156 156 MET MET A . n A 1 38 ASP 38 157 157 ASP ASP A . n A 1 39 LYS 39 158 158 LYS LYS A . n A 1 40 SER 40 159 159 SER SER A . n A 1 41 SER 41 160 160 SER SER A . n A 1 42 ARG 42 161 161 ARG ARG A . n A 1 43 THR 43 162 162 THR THR A . n A 1 44 ARG 44 163 163 ARG ARG A . n A 1 45 LEU 45 164 164 LEU LEU A . n A 1 46 ALA 46 165 165 ALA ALA A . n A 1 47 LEU 47 166 166 LEU LEU A . n A 1 48 ILE 48 167 167 ILE ILE A . n A 1 49 ILE 49 168 168 ILE ILE A . n A 1 50 CYS 50 169 169 CYS CYS A . n A 1 51 ASN 51 170 170 ASN ASN A . n A 1 52 GLU 52 171 171 GLU GLU A . n A 1 53 GLU 53 172 172 GLU GLU A . n A 1 54 PHE 54 173 173 PHE PHE A . n A 1 55 ASP 55 174 174 ASP ASP A . n A 1 56 SER 56 175 175 SER SER A . n A 1 57 ILE 57 176 176 ILE ILE A . n A 1 58 PRO 58 177 177 PRO PRO A . n A 1 59 ARG 59 178 178 ARG ARG A . n A 1 60 ARG 60 179 179 ARG ARG A . n A 1 61 THR 61 180 180 THR THR A . n A 1 62 GLY 62 181 181 GLY GLY A . n A 1 63 ALA 63 182 182 ALA ALA A . n A 1 64 GLU 64 183 183 GLU GLU A . n A 1 65 VAL 65 184 184 VAL VAL A . n A 1 66 ASP 66 185 185 ASP ASP A . n A 1 67 ILE 67 186 186 ILE ILE A . n A 1 68 THR 68 187 187 THR THR A . n A 1 69 GLY 69 188 188 GLY GLY A . n A 1 70 MET 70 189 189 MET MET A . n A 1 71 THR 71 190 190 THR THR A . n A 1 72 MET 72 191 191 MET MET A . n A 1 73 LEU 73 192 192 LEU LEU A . n A 1 74 LEU 74 193 193 LEU LEU A . n A 1 75 GLN 75 194 194 GLN GLN A . n A 1 76 ASN 76 195 195 ASN ASN A . n A 1 77 LEU 77 196 196 LEU LEU A . n A 1 78 GLY 78 197 197 GLY GLY A . n A 1 79 TYR 79 198 198 TYR TYR A . n A 1 80 SER 80 199 199 SER SER A . n A 1 81 VAL 81 200 200 VAL VAL A . n A 1 82 ASP 82 201 201 ASP ASP A . n A 1 83 VAL 83 202 202 VAL VAL A . n A 1 84 LYS 84 203 203 LYS LYS A . n A 1 85 LYS 85 204 204 LYS LYS A . n A 1 86 ASN 86 205 205 ASN ASN A . n A 1 87 LEU 87 206 206 LEU LEU A . n A 1 88 THR 88 207 207 THR THR A . n A 1 89 ALA 89 208 208 ALA ALA A . n A 1 90 SER 90 209 209 SER SER A . n A 1 91 ASP 91 210 210 ASP ASP A . n A 1 92 MET 92 211 211 MET MET A . n A 1 93 THR 93 212 212 THR THR A . n A 1 94 THR 94 213 213 THR THR A . n A 1 95 GLU 95 214 214 GLU GLU A . n A 1 96 LEU 96 215 215 LEU LEU A . n A 1 97 GLU 97 216 216 GLU GLU A . n A 1 98 ALA 98 217 217 ALA ALA A . n A 1 99 PHE 99 218 218 PHE PHE A . n A 1 100 ALA 100 219 219 ALA ALA A . n A 1 101 HIS 101 220 220 HIS HIS A . n A 1 102 ARG 102 221 221 ARG ARG A . n A 1 103 PRO 103 222 222 PRO PRO A . n A 1 104 GLU 104 223 223 GLU GLU A . n A 1 105 HIS 105 224 224 HIS HIS A . n A 1 106 LYS 106 225 225 LYS LYS A . n A 1 107 THR 107 226 226 THR THR A . n A 1 108 SER 108 227 227 SER SER A . n A 1 109 ASP 109 228 228 ASP ASP A . n A 1 110 SER 110 229 229 SER SER A . n A 1 111 THR 111 230 230 THR THR A . n A 1 112 PHE 112 231 231 PHE PHE A . n A 1 113 LEU 113 232 232 LEU LEU A . n A 1 114 VAL 114 233 233 VAL VAL A . n A 1 115 PHE 115 234 234 PHE PHE A . n A 1 116 MET 116 235 235 MET MET A . n A 1 117 SER 117 236 236 SER SER A . n A 1 118 HIS 118 237 237 HIS HIS A . n A 1 119 GLY 119 238 238 GLY GLY A . n A 1 120 ILE 120 239 239 ILE ILE A . n A 1 121 ARG 121 240 240 ARG ARG A . n A 1 122 GLU 122 241 241 GLU GLU A . n A 1 123 GLY 123 242 242 GLY GLY A . n A 1 124 ILE 124 243 243 ILE ILE A . n A 1 125 CYS 125 244 244 CYS CYS A . n A 1 126 GLY 126 245 245 GLY GLY A . n A 1 127 LYS 127 246 246 LYS LYS A . n A 1 128 LYS 128 247 247 LYS LYS A . n A 1 129 HIS 129 248 248 HIS HIS A . n A 1 130 SER 130 249 249 SER SER A . n A 1 131 GLU 131 250 250 GLU GLU A . n A 1 132 GLN 132 251 251 GLN GLN A . n A 1 133 VAL 133 252 252 VAL VAL A . n A 1 134 PRO 134 253 253 PRO PRO A . n A 1 135 ASP 135 254 254 ASP ASP A . n A 1 136 ILE 136 255 255 ILE ILE A . n A 1 137 LEU 137 256 256 LEU LEU A . n A 1 138 GLN 138 257 257 GLN GLN A . n A 1 139 LEU 139 258 258 LEU LEU A . n A 1 140 ASN 140 259 259 ASN ASN A . n A 1 141 ALA 141 260 260 ALA ALA A . n A 1 142 ILE 142 261 261 ILE ILE A . n A 1 143 PHE 143 262 262 PHE PHE A . n A 1 144 ASN 144 263 263 ASN ASN A . n A 1 145 MET 145 264 264 MET MET A . n A 1 146 LEU 146 265 265 LEU LEU A . n A 1 147 ASN 147 266 266 ASN ASN A . n A 1 148 THR 148 267 267 THR THR A . n A 1 149 LYS 149 268 268 LYS LYS A . n A 1 150 ASN 150 269 269 ASN ASN A . n A 1 151 CYS 151 270 270 CYS CYS A . n A 1 152 PRO 152 271 271 PRO PRO A . n A 1 153 SER 153 272 272 SER SER A . n A 1 154 LEU 154 273 273 LEU LEU A . n A 1 155 LYS 155 274 274 LYS LYS A . n A 1 156 ASP 156 275 275 ASP ASP A . n A 1 157 LYS 157 276 276 LYS LYS A . n A 1 158 PRO 158 277 277 PRO PRO A . n A 1 159 LYS 159 278 278 LYS LYS A . n A 1 160 VAL 160 279 279 VAL VAL A . n A 1 161 ILE 161 280 280 ILE ILE A . n A 1 162 ILE 162 281 281 ILE ILE A . n A 1 163 ILE 163 282 282 ILE ILE A . n A 1 164 GLN 164 283 283 GLN GLN A . n A 1 165 ALA 165 284 284 ALA ALA A . n A 1 166 ALA 166 285 285 ALA ALA A . n A 1 167 ARG 167 286 286 ARG ARG A . n A 1 168 GLY 168 287 287 GLY GLY A . n A 1 169 ASP 169 288 288 ASP ASP A . n A 1 170 SER 170 289 289 SER SER A . n A 1 171 PRO 171 290 290 PRO PRO A . n A 1 172 GLY 172 291 291 GLY GLY A . n A 1 173 VAL 173 292 292 VAL VAL A . n A 1 174 VAL 174 293 293 VAL VAL A . n A 1 175 TRP 175 294 294 TRP TRP A . n A 1 176 PHE 176 295 295 PHE PHE A . n A 1 177 LYS 177 296 296 LYS LYS A . n A 1 178 ASP 178 297 297 ASP ASP A . n B 2 1 ALA 1 317 317 ALA ALA B . n B 2 2 ILE 2 318 318 ILE ILE B . n B 2 3 LYS 3 319 319 LYS LYS B . n B 2 4 LYS 4 320 320 LYS LYS B . n B 2 5 ALA 5 321 321 ALA ALA B . n B 2 6 HIS 6 322 322 HIS HIS B . n B 2 7 ILE 7 323 323 ILE ILE B . n B 2 8 GLU 8 324 324 GLU GLU B . n B 2 9 LYS 9 325 325 LYS LYS B . n B 2 10 ASP 10 326 326 ASP ASP B . n B 2 11 PHE 11 327 327 PHE PHE B . n B 2 12 ILE 12 328 328 ILE ILE B . n B 2 13 ALA 13 329 329 ALA ALA B . n B 2 14 PHE 14 330 330 PHE PHE B . n B 2 15 CYS 15 331 331 CYS CYS B . n B 2 16 SER 16 332 332 SER SER B . n B 2 17 SER 17 333 333 SER SER B . n B 2 18 THR 18 334 334 THR THR B . n B 2 19 PRO 19 335 335 PRO PRO B . n B 2 20 ASP 20 336 336 ASP ASP B . n B 2 21 ASN 21 337 337 ASN ASN B . n B 2 22 VAL 22 338 338 VAL VAL B . n B 2 23 SER 23 339 339 SER SER B . n B 2 24 TRP 24 340 340 TRP TRP B . n B 2 25 ARG 25 341 341 ARG ARG B . n B 2 26 HIS 26 342 342 HIS HIS B . n B 2 27 PRO 27 343 343 PRO PRO B . n B 2 28 THR 28 344 344 THR THR B . n B 2 29 MET 29 345 345 MET MET B . n B 2 30 GLY 30 346 346 GLY GLY B . n B 2 31 SER 31 347 347 SER SER B . n B 2 32 VAL 32 348 348 VAL VAL B . n B 2 33 PHE 33 349 349 PHE PHE B . n B 2 34 ILE 34 350 350 ILE ILE B . n B 2 35 GLY 35 351 351 GLY GLY B . n B 2 36 ARG 36 352 352 ARG ARG B . n B 2 37 LEU 37 353 353 LEU LEU B . n B 2 38 ILE 38 354 354 ILE ILE B . n B 2 39 GLU 39 355 355 GLU GLU B . n B 2 40 HIS 40 356 356 HIS HIS B . n B 2 41 MET 41 357 357 MET MET B . n B 2 42 GLN 42 358 358 GLN GLN B . n B 2 43 GLU 43 359 359 GLU GLU B . n B 2 44 TYR 44 360 360 TYR TYR B . n B 2 45 ALA 45 361 361 ALA ALA B . n B 2 46 ALA 46 362 362 ALA ALA B . n B 2 47 SER 47 363 363 SER SER B . n B 2 48 ALA 48 364 364 ALA ALA B . n B 2 49 ASP 49 365 365 ASP ASP B . n B 2 50 VAL 50 366 366 VAL VAL B . n B 2 51 GLU 51 367 367 GLU GLU B . n B 2 52 GLU 52 368 368 GLU GLU B . n B 2 53 ILE 53 369 369 ILE ILE B . n B 2 54 PHE 54 370 370 PHE PHE B . n B 2 55 ARG 55 371 371 ARG ARG B . n B 2 56 LYS 56 372 372 LYS LYS B . n B 2 57 VAL 57 373 373 VAL VAL B . n B 2 58 ARG 58 374 374 ARG ARG B . n B 2 59 PHE 59 375 375 PHE PHE B . n B 2 60 SER 60 376 376 SER SER B . n B 2 61 PHE 61 377 377 PHE PHE B . n B 2 62 GLU 62 378 378 GLU GLU B . n B 2 63 GLN 63 379 379 GLN GLN B . n B 2 64 PRO 64 380 380 PRO PRO B . n B 2 65 ASP 65 381 381 ASP ASP B . n B 2 66 GLY 66 382 382 GLY GLY B . n B 2 67 ARG 67 383 383 ARG ARG B . n B 2 68 ALA 68 384 384 ALA ALA B . n B 2 69 GLN 69 385 385 GLN GLN B . n B 2 70 MET 70 386 386 MET MET B . n B 2 71 PRO 71 387 387 PRO PRO B . n B 2 72 THR 72 388 388 THR THR B . n B 2 73 THR 73 389 389 THR THR B . n B 2 74 GLU 74 390 390 GLU GLU B . n B 2 75 ARG 75 391 391 ARG ARG B . n B 2 76 VAL 76 392 392 VAL VAL B . n B 2 77 THR 77 393 393 THR THR B . n B 2 78 LEU 78 394 394 LEU LEU B . n B 2 79 THR 79 395 395 THR THR B . n B 2 80 ARG 80 396 396 ARG ARG B . n B 2 81 ALA 81 397 397 ALA ALA B . n B 2 82 PHE 82 398 398 PHE PHE B . n B 2 83 TYR 83 399 399 TYR TYR B . n B 2 84 LEU 84 400 400 LEU LEU B . n B 2 85 PHE 85 401 401 PHE PHE B . n B 2 86 PRO 86 402 402 PRO PRO B . n B 2 87 GLY 87 403 403 GLY GLY B . n B 2 88 HIS 88 404 404 HIS HIS B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 F1G 1 1 1 F1G F1G B . D 4 HOH 1 4 4 HOH HOH A . D 4 HOH 2 6 6 HOH HOH A . D 4 HOH 3 8 8 HOH HOH A . D 4 HOH 4 9 9 HOH HOH A . D 4 HOH 5 10 10 HOH HOH A . D 4 HOH 6 11 11 HOH HOH A . D 4 HOH 7 15 15 HOH HOH A . E 4 HOH 1 405 1 HOH HOH B . E 4 HOH 2 406 2 HOH HOH B . E 4 HOH 3 407 3 HOH HOH B . E 4 HOH 4 408 5 HOH HOH B . E 4 HOH 5 409 7 HOH HOH B . E 4 HOH 6 410 12 HOH HOH B . E 4 HOH 7 411 13 HOH HOH B . E 4 HOH 8 412 14 HOH HOH B . E 4 HOH 9 413 16 HOH HOH B . E 4 HOH 10 414 17 HOH HOH B . E 4 HOH 11 415 18 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 13870 ? 1 MORE -76 ? 1 'SSA (A^2)' 20020 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_765 -x+2,-x+y+1,-z+2/3 -0.5000000000 -0.8660254038 0.0000000000 106.5660000000 -0.8660254038 0.5000000000 0.0000000000 61.5259087865 0.0000000000 0.0000000000 -1.0000000000 78.5073333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-05-16 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Version format compliance' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 41.0054 _pdbx_refine_tls.origin_y 28.1484 _pdbx_refine_tls.origin_z 34.1417 _pdbx_refine_tls.T[1][1] -0.0336 _pdbx_refine_tls.T[2][2] 0.0431 _pdbx_refine_tls.T[3][3] 0.0474 _pdbx_refine_tls.T[1][2] -0.0256 _pdbx_refine_tls.T[1][3] -0.0790 _pdbx_refine_tls.T[2][3] -0.0631 _pdbx_refine_tls.L[1][1] 2.0237 _pdbx_refine_tls.L[2][2] 2.3744 _pdbx_refine_tls.L[3][3] 3.4920 _pdbx_refine_tls.L[1][2] 0.5489 _pdbx_refine_tls.L[1][3] -0.0107 _pdbx_refine_tls.L[2][3] -0.3812 _pdbx_refine_tls.S[1][1] 0.1940 _pdbx_refine_tls.S[1][2] 0.1254 _pdbx_refine_tls.S[1][3] -0.2335 _pdbx_refine_tls.S[2][1] 0.1190 _pdbx_refine_tls.S[2][2] -0.0511 _pdbx_refine_tls.S[2][3] -0.0197 _pdbx_refine_tls.S[3][1] 0.3250 _pdbx_refine_tls.S[3][2] -0.1542 _pdbx_refine_tls.S[3][3] -0.1428 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id B _pdbx_refine_tls_group.beg_auth_seq_id 1 _pdbx_refine_tls_group.beg_label_asym_id C _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id B _pdbx_refine_tls_group.end_auth_seq_id 1 _pdbx_refine_tls_group.end_label_asym_id C _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0005 ? 1 CrystalClear 'data reduction' '(MSC/RIGAKU)' ? 2 d*TREK 'data scaling' . ? 3 AMoRE phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 205 ? ? 51.20 83.33 2 1 ILE A 239 ? ? -124.60 -163.78 3 1 PRO A 290 ? ? -31.36 125.59 4 1 HIS B 342 ? ? 59.33 79.06 5 1 SER B 363 ? ? -148.39 -31.69 6 1 ASP B 381 ? ? -138.80 -43.77 7 1 PHE B 401 ? ? 58.18 85.65 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 240 ? CB ? A ARG 121 CB 2 1 Y 1 A ARG 240 ? CG ? A ARG 121 CG 3 1 Y 1 A ARG 240 ? CD ? A ARG 121 CD 4 1 Y 1 A ARG 240 ? NE ? A ARG 121 NE 5 1 Y 1 A ARG 240 ? CZ ? A ARG 121 CZ 6 1 Y 1 A ARG 240 ? NH1 ? A ARG 121 NH1 7 1 Y 1 A ARG 240 ? NH2 ? A ARG 121 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 120 ? A ASN 1 2 1 Y 1 A PRO 121 ? A PRO 2 3 1 Y 1 A ALA 122 ? A ALA 3 4 1 Y 1 A MET 123 ? A MET 4 5 1 Y 1 A PRO 124 ? A PRO 5 6 1 Y 1 A THR 125 ? A THR 6 7 1 Y 1 A SER 126 ? A SER 7 8 1 Y 1 A SER 127 ? A SER 8 9 1 Y 1 A GLY 128 ? A GLY 9 10 1 Y 1 A SER 129 ? A SER 10 11 1 Y 1 A GLU 130 ? A GLU 11 12 1 Y 1 A GLY 131 ? A GLY 12 13 1 Y 1 A ASN 132 ? A ASN 13 14 1 Y 1 A VAL 133 ? A VAL 14 15 1 Y 1 A LYS 134 ? A LYS 15 16 1 Y 1 A LEU 135 ? A LEU 16 17 1 Y 1 A CYS 136 ? A CYS 17 18 1 Y 1 A SER 137 ? A SER 18 19 1 Y 1 A LEU 138 ? A LEU 19 20 1 Y 1 A GLU 139 ? A GLU 20 21 1 Y 1 A GLU 140 ? A GLU 21 22 1 Y 1 A ALA 141 ? A ALA 22 23 1 Y 1 A GLN 142 ? A GLN 23 24 1 Y 1 A ARG 143 ? A ARG 24 25 1 Y 1 A ILE 144 ? A ILE 25 26 1 Y 1 A TRP 145 ? A TRP 26 27 1 Y 1 A LYS 146 ? A LYS 27 28 1 Y 1 A GLN 147 ? A GLN 28 29 1 Y 1 A LYS 148 ? A LYS 29 30 1 Y 1 A SER 149 ? A SER 30 31 1 Y 1 A ALA 150 ? A ALA 31 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 '1-METHYL-3-TRIFLUOROMETHYL-1H-THIENO[2,3-C]PYRAZOLE-5-CARBOXYLIC ACID (2-MERCAPTO-ETHYL)-AMIDE' F1G 4 water HOH #