data_2G7L # _entry.id 2G7L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2G7L RCSB RCSB036788 WWPDB D_1000036788 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC6062 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2G7L _pdbx_database_status.recvd_initial_deposition_date 2006-02-28 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ezersky, A.' 1 'Lunin, V.V.' 2 'Skarina, T.' 3 'Wierzbicka, M.' 4 'Joachimiak, A.' 5 'Edwards, A.M.' 6 'Savchenko, A.' 7 'Midwest Center for Structural Genomics (MCSG)' 8 # _citation.id primary _citation.title 'Crystal structure of putative transcription regulator SCO7704 from Streptomyces coelicor' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ezersky, A.' 1 primary 'Lunin, V.V.' 2 primary 'Skarina, T.' 3 primary 'Wierzbicka, M.' 4 primary 'Joachimiak, A.' 5 primary 'Edwards, A.M.' 6 primary 'Savchenko, A.' 7 # _cell.entry_id 2G7L _cell.length_a 96.099 _cell.length_b 96.099 _cell.length_c 59.096 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2G7L _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TetR-family transcriptional regulator' 26632.475 1 ? ? ? ? 2 water nat water 18.015 59 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)AARRAPISRRDRPAKPALSRRWIVDTAVAL(MSE)RAEGLEKVT(MSE)RRLAQELDTGPASLYVYVANTAELHA AVLDALLGEVDLTGAGAEEDWREQLRAVLTSYTLVLFAHPQLARSALVARPSGENYLRLVERVLELLARSGAPGAQVAWG VDKLLQDATATAAEQATQEHDPASHEDWSATVRALRDADEATHPAIASH(MSE)PLLVAGSAHDRLRWSFDVLVNGITRT PVPGPARGAAGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAARRAPISRRDRPAKPALSRRWIVDTAVALMRAEGLEKVTMRRLAQELDTGPASLYVYVANTAELHAAVLDALLGEVDL TGAGAEEDWREQLRAVLTSYTLVLFAHPQLARSALVARPSGENYLRLVERVLELLARSGAPGAQVAWGVDKLLQDATATA AEQATQEHDPASHEDWSATVRALRDADEATHPAIASHMPLLVAGSAHDRLRWSFDVLVNGITRTPVPGPARGAAGLEHHH HHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC6062 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ALA n 1 3 ALA n 1 4 ARG n 1 5 ARG n 1 6 ALA n 1 7 PRO n 1 8 ILE n 1 9 SER n 1 10 ARG n 1 11 ARG n 1 12 ASP n 1 13 ARG n 1 14 PRO n 1 15 ALA n 1 16 LYS n 1 17 PRO n 1 18 ALA n 1 19 LEU n 1 20 SER n 1 21 ARG n 1 22 ARG n 1 23 TRP n 1 24 ILE n 1 25 VAL n 1 26 ASP n 1 27 THR n 1 28 ALA n 1 29 VAL n 1 30 ALA n 1 31 LEU n 1 32 MSE n 1 33 ARG n 1 34 ALA n 1 35 GLU n 1 36 GLY n 1 37 LEU n 1 38 GLU n 1 39 LYS n 1 40 VAL n 1 41 THR n 1 42 MSE n 1 43 ARG n 1 44 ARG n 1 45 LEU n 1 46 ALA n 1 47 GLN n 1 48 GLU n 1 49 LEU n 1 50 ASP n 1 51 THR n 1 52 GLY n 1 53 PRO n 1 54 ALA n 1 55 SER n 1 56 LEU n 1 57 TYR n 1 58 VAL n 1 59 TYR n 1 60 VAL n 1 61 ALA n 1 62 ASN n 1 63 THR n 1 64 ALA n 1 65 GLU n 1 66 LEU n 1 67 HIS n 1 68 ALA n 1 69 ALA n 1 70 VAL n 1 71 LEU n 1 72 ASP n 1 73 ALA n 1 74 LEU n 1 75 LEU n 1 76 GLY n 1 77 GLU n 1 78 VAL n 1 79 ASP n 1 80 LEU n 1 81 THR n 1 82 GLY n 1 83 ALA n 1 84 GLY n 1 85 ALA n 1 86 GLU n 1 87 GLU n 1 88 ASP n 1 89 TRP n 1 90 ARG n 1 91 GLU n 1 92 GLN n 1 93 LEU n 1 94 ARG n 1 95 ALA n 1 96 VAL n 1 97 LEU n 1 98 THR n 1 99 SER n 1 100 TYR n 1 101 THR n 1 102 LEU n 1 103 VAL n 1 104 LEU n 1 105 PHE n 1 106 ALA n 1 107 HIS n 1 108 PRO n 1 109 GLN n 1 110 LEU n 1 111 ALA n 1 112 ARG n 1 113 SER n 1 114 ALA n 1 115 LEU n 1 116 VAL n 1 117 ALA n 1 118 ARG n 1 119 PRO n 1 120 SER n 1 121 GLY n 1 122 GLU n 1 123 ASN n 1 124 TYR n 1 125 LEU n 1 126 ARG n 1 127 LEU n 1 128 VAL n 1 129 GLU n 1 130 ARG n 1 131 VAL n 1 132 LEU n 1 133 GLU n 1 134 LEU n 1 135 LEU n 1 136 ALA n 1 137 ARG n 1 138 SER n 1 139 GLY n 1 140 ALA n 1 141 PRO n 1 142 GLY n 1 143 ALA n 1 144 GLN n 1 145 VAL n 1 146 ALA n 1 147 TRP n 1 148 GLY n 1 149 VAL n 1 150 ASP n 1 151 LYS n 1 152 LEU n 1 153 LEU n 1 154 GLN n 1 155 ASP n 1 156 ALA n 1 157 THR n 1 158 ALA n 1 159 THR n 1 160 ALA n 1 161 ALA n 1 162 GLU n 1 163 GLN n 1 164 ALA n 1 165 THR n 1 166 GLN n 1 167 GLU n 1 168 HIS n 1 169 ASP n 1 170 PRO n 1 171 ALA n 1 172 SER n 1 173 HIS n 1 174 GLU n 1 175 ASP n 1 176 TRP n 1 177 SER n 1 178 ALA n 1 179 THR n 1 180 VAL n 1 181 ARG n 1 182 ALA n 1 183 LEU n 1 184 ARG n 1 185 ASP n 1 186 ALA n 1 187 ASP n 1 188 GLU n 1 189 ALA n 1 190 THR n 1 191 HIS n 1 192 PRO n 1 193 ALA n 1 194 ILE n 1 195 ALA n 1 196 SER n 1 197 HIS n 1 198 MSE n 1 199 PRO n 1 200 LEU n 1 201 LEU n 1 202 VAL n 1 203 ALA n 1 204 GLY n 1 205 SER n 1 206 ALA n 1 207 HIS n 1 208 ASP n 1 209 ARG n 1 210 LEU n 1 211 ARG n 1 212 TRP n 1 213 SER n 1 214 PHE n 1 215 ASP n 1 216 VAL n 1 217 LEU n 1 218 VAL n 1 219 ASN n 1 220 GLY n 1 221 ILE n 1 222 THR n 1 223 ARG n 1 224 THR n 1 225 PRO n 1 226 VAL n 1 227 PRO n 1 228 GLY n 1 229 PRO n 1 230 ALA n 1 231 ARG n 1 232 GLY n 1 233 ALA n 1 234 ALA n 1 235 GLY n 1 236 LEU n 1 237 GLU n 1 238 HIS n 1 239 HIS n 1 240 HIS n 1 241 HIS n 1 242 HIS n 1 243 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Streptomyces _entity_src_gen.pdbx_gene_src_gene SCO7704 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain A3 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces coelicolor' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1902 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-21d(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code CAC44560 _struct_ref.pdbx_db_accession 15020677 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAARRAPISRRDRPAKPALSRRWIVDTAVALMRAEGLEKVTMRRLAQELDTGPASLYVYVANTAELHAAVLDALLGEVDL TGAGAEEDWREQLRAVLTSYTLVLFAHPQLARSALVARPSGENYLRLVERVLELLARSGAPGAQVAWGVDKLLQDATATA AEQATQEHDPASHEDWSATVRALRDADEATHPAIASHMPLLVAGSAHDRLRWSFDVLVNGITRTPVPGPARGAAG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2G7L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 235 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 15020677 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 235 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 235 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2G7L MSE A 1 ? GB 15020677 MET 1 'MODIFIED RESIDUE' 1 1 1 2G7L MSE A 32 ? GB 15020677 MET 32 'MODIFIED RESIDUE' 32 2 1 2G7L MSE A 42 ? GB 15020677 MET 42 'MODIFIED RESIDUE' 42 3 1 2G7L MSE A 198 ? GB 15020677 MET 198 'MODIFIED RESIDUE' 198 4 1 2G7L LEU A 236 ? GB 15020677 ? ? 'cloning artifact' 236 5 1 2G7L GLU A 237 ? GB 15020677 ? ? 'cloning artifact' 237 6 1 2G7L HIS A 238 ? GB 15020677 ? ? 'EXPRESSION TAG' 238 7 1 2G7L HIS A 239 ? GB 15020677 ? ? 'EXPRESSION TAG' 239 8 1 2G7L HIS A 240 ? GB 15020677 ? ? 'EXPRESSION TAG' 240 9 1 2G7L HIS A 241 ? GB 15020677 ? ? 'EXPRESSION TAG' 241 10 1 2G7L HIS A 242 ? GB 15020677 ? ? 'EXPRESSION TAG' 242 11 1 2G7L HIS A 243 ? GB 15020677 ? ? 'EXPRESSION TAG' 243 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2G7L _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.67 _exptl_crystal.density_percent_sol 53.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '4M NaCl, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2005-11-26 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.969 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.969 # _reflns.entry_id 2G7L _reflns.observed_criterion_sigma_I -1 _reflns.observed_criterion_sigma_F -1 _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.1 _reflns.number_obs 16602 _reflns.number_all 16602 _reflns.percent_possible_obs 99.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.074 _reflns.pdbx_netI_over_sigmaI 32 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 13.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.18 _reflns_shell.percent_possible_all 93 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.469 _reflns_shell.meanI_over_sigI_obs 4 _reflns_shell.pdbx_redundancy 9.8 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1526 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2G7L _refine.ls_number_reflns_obs 15626 _refine.ls_number_reflns_all 15626 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.00 _refine.ls_d_res_high 2.10 _refine.ls_percent_reflns_obs 98.64 _refine.ls_R_factor_obs 0.22815 _refine.ls_R_factor_all 0.22815 _refine.ls_R_factor_R_work 0.22529 _refine.ls_R_factor_R_free 0.28587 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 836 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.956 _refine.correlation_coeff_Fo_to_Fc_free 0.943 _refine.B_iso_mean 58.024 _refine.aniso_B[1][1] -1.99 _refine.aniso_B[2][2] -1.99 _refine.aniso_B[3][3] 3.98 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.202 _refine.pdbx_overall_ESU_R_Free 0.197 _refine.overall_SU_ML 0.168 _refine.overall_SU_B 6.447 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1524 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 59 _refine_hist.number_atoms_total 1583 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 50.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.023 0.022 ? 1572 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.924 1.968 ? 2147 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 7.112 5.000 ? 202 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 39.461 22.273 ? 66 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 21.396 15.000 ? 249 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 22.153 15.000 ? 18 'X-RAY DIFFRACTION' ? r_chiral_restr 0.200 0.200 ? 257 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.008 0.020 ? 1186 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.230 0.200 ? 757 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.307 0.200 ? 1071 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.186 0.200 ? 63 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.268 0.200 ? 63 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.123 0.200 ? 11 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.267 1.500 ? 1044 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.084 2.000 ? 1619 'X-RAY DIFFRACTION' ? r_scbond_it 2.966 3.000 ? 604 'X-RAY DIFFRACTION' ? r_scangle_it 4.630 4.500 ? 528 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.100 _refine_ls_shell.d_res_low 2.155 _refine_ls_shell.number_reflns_R_work 1011 _refine_ls_shell.R_factor_R_work 0.295 _refine_ls_shell.percent_reflns_obs 89.55 _refine_ls_shell.R_factor_R_free 0.319 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 60 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2G7L _struct.title 'Crystal structure of putative transcription regulator SCO7704 from Streptomyces coelicor' _struct.pdbx_descriptor 'TetR-family transcriptional regulator' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2G7L _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'APC6062, SCO7704, transcription, Protein Structure Initiative, PSI, Midwest Center for Structural Genomics, MCSG' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details 'Biological assembly is a dimer composed of protein molecule from asymmetric unit and symmetry-related molecule (Y,X,-Z).' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 20 ? GLY A 36 ? SER A 20 GLY A 36 1 ? 17 HELX_P HELX_P2 2 THR A 41 ? LEU A 49 ? THR A 41 LEU A 49 1 ? 9 HELX_P HELX_P3 3 GLY A 52 ? TYR A 57 ? GLY A 52 TYR A 57 1 ? 6 HELX_P HELX_P4 4 ASN A 62 ? LEU A 75 ? ASN A 62 LEU A 75 1 ? 14 HELX_P HELX_P5 5 ASP A 88 ? HIS A 107 ? ASP A 88 HIS A 107 1 ? 20 HELX_P HELX_P6 6 HIS A 107 ? ALA A 117 ? HIS A 107 ALA A 117 1 ? 11 HELX_P HELX_P7 7 GLY A 121 ? ARG A 137 ? GLY A 121 ARG A 137 1 ? 17 HELX_P HELX_P8 8 PRO A 141 ? GLU A 162 ? PRO A 141 GLU A 162 1 ? 22 HELX_P HELX_P9 9 SER A 177 ? ALA A 186 ? SER A 177 ALA A 186 1 ? 10 HELX_P HELX_P10 10 HIS A 191 ? MSE A 198 ? HIS A 191 MSE A 198 1 ? 8 HELX_P HELX_P11 11 SER A 205 ? THR A 224 ? SER A 205 THR A 224 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A LEU 31 C ? ? ? 1_555 A MSE 32 N ? ? A LEU 31 A MSE 32 1_555 ? ? ? ? ? ? ? 1.345 ? covale2 covale ? ? A MSE 32 C ? ? ? 1_555 A ARG 33 N ? ? A MSE 32 A ARG 33 1_555 ? ? ? ? ? ? ? 1.323 ? covale3 covale ? ? A THR 41 C ? ? ? 1_555 A MSE 42 N ? ? A THR 41 A MSE 42 1_555 ? ? ? ? ? ? ? 1.330 ? covale4 covale ? ? A MSE 42 C ? ? ? 1_555 A ARG 43 N ? ? A MSE 42 A ARG 43 1_555 ? ? ? ? ? ? ? 1.338 ? covale5 covale ? ? A HIS 197 C ? ? ? 1_555 A MSE 198 N ? ? A HIS 197 A MSE 198 1_555 ? ? ? ? ? ? ? 1.334 ? covale6 covale ? ? A MSE 198 C ? ? ? 1_555 A PRO 199 N ? ? A MSE 198 A PRO 199 1_555 ? ? ? ? ? ? ? 1.352 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MSE _struct_mon_prot_cis.label_seq_id 198 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MSE _struct_mon_prot_cis.auth_seq_id 198 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 199 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 199 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 10.21 # _database_PDB_matrix.entry_id 2G7L _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2G7L _atom_sites.fract_transf_matrix[1][1] 0.010406 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010406 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016922 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 ARG 4 4 ? ? ? A . n A 1 5 ARG 5 5 ? ? ? A . n A 1 6 ALA 6 6 ? ? ? A . n A 1 7 PRO 7 7 ? ? ? A . n A 1 8 ILE 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 ARG 10 10 ? ? ? A . n A 1 11 ARG 11 11 ? ? ? A . n A 1 12 ASP 12 12 ? ? ? A . n A 1 13 ARG 13 13 ? ? ? A . n A 1 14 PRO 14 14 ? ? ? A . n A 1 15 ALA 15 15 ? ? ? A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 MSE 32 32 32 MSE MSE A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 MSE 42 42 42 MSE MSE A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLY 84 84 ? ? ? A . n A 1 85 ALA 85 85 ? ? ? A . n A 1 86 GLU 86 86 ? ? ? A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 GLN 144 144 144 GLN GLN A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 TRP 147 147 147 TRP TRP A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 GLN 154 154 154 GLN GLN A . n A 1 155 ASP 155 155 155 ASP ASP A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 GLN 166 166 ? ? ? A . n A 1 167 GLU 167 167 ? ? ? A . n A 1 168 HIS 168 168 ? ? ? A . n A 1 169 ASP 169 169 ? ? ? A . n A 1 170 PRO 170 170 ? ? ? A . n A 1 171 ALA 171 171 ? ? ? A . n A 1 172 SER 172 172 ? ? ? A . n A 1 173 HIS 173 173 ? ? ? A . n A 1 174 GLU 174 174 ? ? ? A . n A 1 175 ASP 175 175 ? ? ? A . n A 1 176 TRP 176 176 ? ? ? A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 THR 190 190 190 THR THR A . n A 1 191 HIS 191 191 191 HIS HIS A . n A 1 192 PRO 192 192 192 PRO PRO A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 HIS 197 197 197 HIS HIS A . n A 1 198 MSE 198 198 198 MSE MSE A . n A 1 199 PRO 199 199 199 PRO PRO A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 ALA 206 206 206 ALA ALA A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 ASP 208 208 208 ASP ASP A . n A 1 209 ARG 209 209 209 ARG ARG A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 ARG 211 211 211 ARG ARG A . n A 1 212 TRP 212 212 212 TRP TRP A . n A 1 213 SER 213 213 213 SER SER A . n A 1 214 PHE 214 214 214 PHE PHE A . n A 1 215 ASP 215 215 215 ASP ASP A . n A 1 216 VAL 216 216 216 VAL VAL A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 ASN 219 219 219 ASN ASN A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 ILE 221 221 221 ILE ILE A . n A 1 222 THR 222 222 222 THR THR A . n A 1 223 ARG 223 223 223 ARG ARG A . n A 1 224 THR 224 224 224 THR THR A . n A 1 225 PRO 225 225 225 PRO PRO A . n A 1 226 VAL 226 226 226 VAL VAL A . n A 1 227 PRO 227 227 227 PRO PRO A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 PRO 229 229 229 PRO PRO A . n A 1 230 ALA 230 230 230 ALA ALA A . n A 1 231 ARG 231 231 ? ? ? A . n A 1 232 GLY 232 232 ? ? ? A . n A 1 233 ALA 233 233 ? ? ? A . n A 1 234 ALA 234 234 ? ? ? A . n A 1 235 GLY 235 235 ? ? ? A . n A 1 236 LEU 236 236 ? ? ? A . n A 1 237 GLU 237 237 ? ? ? A . n A 1 238 HIS 238 238 ? ? ? A . n A 1 239 HIS 239 239 ? ? ? A . n A 1 240 HIS 240 240 ? ? ? A . n A 1 241 HIS 241 241 ? ? ? A . n A 1 242 HIS 242 242 ? ? ? A . n A 1 243 HIS 243 243 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 244 1 HOH HOH A . B 2 HOH 2 245 2 HOH HOH A . B 2 HOH 3 246 3 HOH HOH A . B 2 HOH 4 247 4 HOH HOH A . B 2 HOH 5 248 5 HOH HOH A . B 2 HOH 6 249 6 HOH HOH A . B 2 HOH 7 250 7 HOH HOH A . B 2 HOH 8 251 8 HOH HOH A . B 2 HOH 9 252 9 HOH HOH A . B 2 HOH 10 253 10 HOH HOH A . B 2 HOH 11 254 11 HOH HOH A . B 2 HOH 12 255 12 HOH HOH A . B 2 HOH 13 256 13 HOH HOH A . B 2 HOH 14 257 14 HOH HOH A . B 2 HOH 15 258 15 HOH HOH A . B 2 HOH 16 259 16 HOH HOH A . B 2 HOH 17 260 17 HOH HOH A . B 2 HOH 18 261 18 HOH HOH A . B 2 HOH 19 262 19 HOH HOH A . B 2 HOH 20 263 20 HOH HOH A . B 2 HOH 21 264 21 HOH HOH A . B 2 HOH 22 265 22 HOH HOH A . B 2 HOH 23 266 23 HOH HOH A . B 2 HOH 24 267 24 HOH HOH A . B 2 HOH 25 268 25 HOH HOH A . B 2 HOH 26 269 26 HOH HOH A . B 2 HOH 27 270 27 HOH HOH A . B 2 HOH 28 271 28 HOH HOH A . B 2 HOH 29 272 29 HOH HOH A . B 2 HOH 30 273 30 HOH HOH A . B 2 HOH 31 274 31 HOH HOH A . B 2 HOH 32 275 32 HOH HOH A . B 2 HOH 33 276 33 HOH HOH A . B 2 HOH 34 277 34 HOH HOH A . B 2 HOH 35 278 35 HOH HOH A . B 2 HOH 36 279 36 HOH HOH A . B 2 HOH 37 280 37 HOH HOH A . B 2 HOH 38 281 38 HOH HOH A . B 2 HOH 39 282 39 HOH HOH A . B 2 HOH 40 283 40 HOH HOH A . B 2 HOH 41 284 41 HOH HOH A . B 2 HOH 42 285 42 HOH HOH A . B 2 HOH 43 286 43 HOH HOH A . B 2 HOH 44 287 44 HOH HOH A . B 2 HOH 45 288 45 HOH HOH A . B 2 HOH 46 289 46 HOH HOH A . B 2 HOH 47 290 47 HOH HOH A . B 2 HOH 48 291 48 HOH HOH A . B 2 HOH 49 292 49 HOH HOH A . B 2 HOH 50 293 50 HOH HOH A . B 2 HOH 51 294 51 HOH HOH A . B 2 HOH 52 295 52 HOH HOH A . B 2 HOH 53 296 55 HOH HOH A . B 2 HOH 54 297 56 HOH HOH A . B 2 HOH 55 298 57 HOH HOH A . B 2 HOH 56 299 3 HOH HOH A . B 2 HOH 57 300 5 HOH HOH A . B 2 HOH 58 301 9 HOH HOH A . B 2 HOH 59 302 12 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 32 A MSE 32 ? MET SELENOMETHIONINE 2 A MSE 42 A MSE 42 ? MET SELENOMETHIONINE 3 A MSE 198 A MSE 198 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5350 ? 1 MORE -33 ? 1 'SSA (A^2)' 18050 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 59.0960000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-03-14 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_software.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SnB phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 37 ? ? 135.04 -34.32 2 1 SER A 120 ? ? -144.71 16.35 3 1 GLU A 188 ? ? -36.76 -38.76 4 1 PRO A 229 ? ? -34.06 132.07 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 GLU A 87 ? ? ASP A 88 ? ? 134.25 2 1 ASP A 88 ? ? TRP A 89 ? ? -137.13 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A ARG 4 ? A ARG 4 5 1 Y 1 A ARG 5 ? A ARG 5 6 1 Y 1 A ALA 6 ? A ALA 6 7 1 Y 1 A PRO 7 ? A PRO 7 8 1 Y 1 A ILE 8 ? A ILE 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A ARG 10 ? A ARG 10 11 1 Y 1 A ARG 11 ? A ARG 11 12 1 Y 1 A ASP 12 ? A ASP 12 13 1 Y 1 A ARG 13 ? A ARG 13 14 1 Y 1 A PRO 14 ? A PRO 14 15 1 Y 1 A ALA 15 ? A ALA 15 16 1 Y 1 A GLY 84 ? A GLY 84 17 1 Y 1 A ALA 85 ? A ALA 85 18 1 Y 1 A GLU 86 ? A GLU 86 19 1 Y 1 A GLN 166 ? A GLN 166 20 1 Y 1 A GLU 167 ? A GLU 167 21 1 Y 1 A HIS 168 ? A HIS 168 22 1 Y 1 A ASP 169 ? A ASP 169 23 1 Y 1 A PRO 170 ? A PRO 170 24 1 Y 1 A ALA 171 ? A ALA 171 25 1 Y 1 A SER 172 ? A SER 172 26 1 Y 1 A HIS 173 ? A HIS 173 27 1 Y 1 A GLU 174 ? A GLU 174 28 1 Y 1 A ASP 175 ? A ASP 175 29 1 Y 1 A TRP 176 ? A TRP 176 30 1 Y 1 A ARG 231 ? A ARG 231 31 1 Y 1 A GLY 232 ? A GLY 232 32 1 Y 1 A ALA 233 ? A ALA 233 33 1 Y 1 A ALA 234 ? A ALA 234 34 1 Y 1 A GLY 235 ? A GLY 235 35 1 Y 1 A LEU 236 ? A LEU 236 36 1 Y 1 A GLU 237 ? A GLU 237 37 1 Y 1 A HIS 238 ? A HIS 238 38 1 Y 1 A HIS 239 ? A HIS 239 39 1 Y 1 A HIS 240 ? A HIS 240 40 1 Y 1 A HIS 241 ? A HIS 241 41 1 Y 1 A HIS 242 ? A HIS 242 42 1 Y 1 A HIS 243 ? A HIS 243 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #