data_2GF9 # _entry.id 2GF9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.377 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2GF9 pdb_00002gf9 10.2210/pdb2gf9/pdb RCSB RCSB037044 ? ? WWPDB D_1000037044 ? ? # _pdbx_database_status.entry_id 2GF9 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2006-03-21 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hong, B.' 1 'Wang, J.' 2 'Shen, L.' 3 'Tempel, W.' 4 'Landry, R.' 5 'Arrowsmith, C.H.' 6 'Edwards, A.M.' 7 'Sundstrom, M.' 8 'Weigelt, J.' 9 'Bochkarev, A.' 10 'Park, H.' 11 'Structural Genomics Consortium (SGC)' 12 # _citation.id primary _citation.title 'Crystal structure of human RAB3D in complex with GDP' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hong, B.' 1 ? primary 'Wang, J.' 2 ? primary 'Shen, L.' 3 ? primary 'Tempel, W.' 4 ? primary 'Landry, R.' 5 ? primary 'Arrowsmith, C.H.' 6 ? primary 'Edwards, A.M.' 7 ? primary 'Sundstrom, M.' 8 ? primary 'Weigelt, J.' 9 ? primary 'Bochkarev, A.' 10 ? primary 'Park, H.' 11 ? # _cell.length_a 35.700 _cell.length_b 63.222 _cell.length_c 67.695 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.entry_id 2GF9 _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.Int_Tables_number 19 _symmetry.entry_id 2GF9 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ras-related protein Rab-3D' 21673.424 1 ? ? 'residues 20-189' ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn 'UNKNOWN ATOM OR ION' ? 2 ? ? ? ? 4 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE" 443.201 1 ? ? ? ? 5 water nat water 18.015 183 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAG QERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFE FFEASAKENINVKQVFERLVDVICEKMNE ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAG QERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFE FFEASAKENINVKQVFERLVDVICEKMNE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 ASP n 1 21 TYR n 1 22 MET n 1 23 PHE n 1 24 LYS n 1 25 LEU n 1 26 LEU n 1 27 LEU n 1 28 ILE n 1 29 GLY n 1 30 ASN n 1 31 SER n 1 32 SER n 1 33 VAL n 1 34 GLY n 1 35 LYS n 1 36 THR n 1 37 SER n 1 38 PHE n 1 39 LEU n 1 40 PHE n 1 41 ARG n 1 42 TYR n 1 43 ALA n 1 44 ASP n 1 45 ASP n 1 46 SER n 1 47 PHE n 1 48 THR n 1 49 PRO n 1 50 ALA n 1 51 PHE n 1 52 VAL n 1 53 SER n 1 54 THR n 1 55 VAL n 1 56 GLY n 1 57 ILE n 1 58 ASP n 1 59 PHE n 1 60 LYS n 1 61 VAL n 1 62 LYS n 1 63 THR n 1 64 VAL n 1 65 TYR n 1 66 ARG n 1 67 HIS n 1 68 ASP n 1 69 LYS n 1 70 ARG n 1 71 ILE n 1 72 LYS n 1 73 LEU n 1 74 GLN n 1 75 ILE n 1 76 TRP n 1 77 ASP n 1 78 THR n 1 79 ALA n 1 80 GLY n 1 81 GLN n 1 82 GLU n 1 83 ARG n 1 84 TYR n 1 85 ARG n 1 86 THR n 1 87 ILE n 1 88 THR n 1 89 THR n 1 90 ALA n 1 91 TYR n 1 92 TYR n 1 93 ARG n 1 94 GLY n 1 95 ALA n 1 96 MET n 1 97 GLY n 1 98 PHE n 1 99 LEU n 1 100 LEU n 1 101 MET n 1 102 TYR n 1 103 ASP n 1 104 ILE n 1 105 ALA n 1 106 ASN n 1 107 GLN n 1 108 GLU n 1 109 SER n 1 110 PHE n 1 111 ALA n 1 112 ALA n 1 113 VAL n 1 114 GLN n 1 115 ASP n 1 116 TRP n 1 117 ALA n 1 118 THR n 1 119 GLN n 1 120 ILE n 1 121 LYS n 1 122 THR n 1 123 TYR n 1 124 SER n 1 125 TRP n 1 126 ASP n 1 127 ASN n 1 128 ALA n 1 129 GLN n 1 130 VAL n 1 131 ILE n 1 132 LEU n 1 133 VAL n 1 134 GLY n 1 135 ASN n 1 136 LYS n 1 137 CYS n 1 138 ASP n 1 139 LEU n 1 140 GLU n 1 141 ASP n 1 142 GLU n 1 143 ARG n 1 144 VAL n 1 145 VAL n 1 146 PRO n 1 147 ALA n 1 148 GLU n 1 149 ASP n 1 150 GLY n 1 151 ARG n 1 152 ARG n 1 153 LEU n 1 154 ALA n 1 155 ASP n 1 156 ASP n 1 157 LEU n 1 158 GLY n 1 159 PHE n 1 160 GLU n 1 161 PHE n 1 162 PHE n 1 163 GLU n 1 164 ALA n 1 165 SER n 1 166 ALA n 1 167 LYS n 1 168 GLU n 1 169 ASN n 1 170 ILE n 1 171 ASN n 1 172 VAL n 1 173 LYS n 1 174 GLN n 1 175 VAL n 1 176 PHE n 1 177 GLU n 1 178 ARG n 1 179 LEU n 1 180 VAL n 1 181 ASP n 1 182 VAL n 1 183 ILE n 1 184 CYS n 1 185 GLU n 1 186 LYS n 1 187 MET n 1 188 ASN n 1 189 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'RAB3D, GOV, RAB16' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-CodonPlus(DE-3)-RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name p28a-LIC _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RAB3D_HUMAN _struct_ref.pdbx_db_accession O95716 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 20 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2GF9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 20 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 189 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O95716 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 189 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 20 _struct_ref_seq.pdbx_auth_seq_align_end 189 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2GF9 MET A 1 ? UNP O95716 ? ? 'initiating methionine' 1 1 1 2GF9 GLY A 2 ? UNP O95716 ? ? 'cloning artifact' 2 2 1 2GF9 SER A 3 ? UNP O95716 ? ? 'cloning artifact' 3 3 1 2GF9 SER A 4 ? UNP O95716 ? ? 'cloning artifact' 4 4 1 2GF9 HIS A 5 ? UNP O95716 ? ? 'expression tag' 5 5 1 2GF9 HIS A 6 ? UNP O95716 ? ? 'expression tag' 6 6 1 2GF9 HIS A 7 ? UNP O95716 ? ? 'expression tag' 7 7 1 2GF9 HIS A 8 ? UNP O95716 ? ? 'expression tag' 8 8 1 2GF9 HIS A 9 ? UNP O95716 ? ? 'expression tag' 9 9 1 2GF9 HIS A 10 ? UNP O95716 ? ? 'expression tag' 10 10 1 2GF9 SER A 11 ? UNP O95716 ? ? 'cloning artifact' 11 11 1 2GF9 SER A 12 ? UNP O95716 ? ? 'cloning artifact' 12 12 1 2GF9 GLY A 13 ? UNP O95716 ? ? 'cloning artifact' 13 13 1 2GF9 LEU A 14 ? UNP O95716 ? ? 'cloning artifact' 14 14 1 2GF9 VAL A 15 ? UNP O95716 ? ? 'cloning artifact' 15 15 1 2GF9 PRO A 16 ? UNP O95716 ? ? 'cloning artifact' 16 16 1 2GF9 ARG A 17 ? UNP O95716 ? ? 'cloning artifact' 17 17 1 2GF9 GLY A 18 ? UNP O95716 ? ? 'cloning artifact' 18 18 1 2GF9 SER A 19 ? UNP O95716 ? ? 'cloning artifact' 19 19 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GDP 'RNA linking' n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UNX non-polymer . 'UNKNOWN ATOM OR ION' ? ? ? VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' _exptl.entry_id 2GF9 # _exptl_crystal.id 1 _exptl_crystal.density_percent_sol 30.20 _exptl_crystal.density_Matthews 1.9 _exptl_crystal.density_meas ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.temp 291 _exptl_crystal_grow.pdbx_details '20% PEG8000, 0.2M magnesium acetate, 0.1M sodium cacodylate, pH 6.5, vapor diffusion, sitting drop, temperature 291K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS' _diffrn_detector.pdbx_collection_date 2006-03-13 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? # _reflns.entry_id 2GF9 _reflns.d_resolution_high 1.530 _reflns.d_resolution_low 28.25 _reflns.number_obs 21079 _reflns.pdbx_Rmerge_I_obs 0.035 _reflns.pdbx_netI_over_sigmaI 32.800 _reflns.pdbx_chi_squared 1.560 _reflns.pdbx_redundancy 7.400 _reflns.percent_possible_obs 88.300 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal 1.53 1.58 ? ? 659 0.056 ? ? 0.731 1.80 28.00 ? ? ? 1 1.58 1.65 ? ? 1538 0.056 ? ? 0.880 2.90 65.50 ? ? ? 2 1.65 1.72 ? ? 2071 0.055 ? ? 1.114 4.20 88.70 ? ? ? 3 1.72 1.81 ? ? 2348 0.052 ? ? 1.251 7.00 99.80 ? ? ? 4 1.81 1.93 ? ? 2351 0.048 ? ? 1.392 8.50 100.00 ? ? ? 5 1.93 2.08 ? ? 2376 0.042 ? ? 1.512 8.60 100.00 ? ? ? 6 2.08 2.29 ? ? 2357 0.04 ? ? 1.652 8.70 100.00 ? ? ? 7 2.29 2.62 ? ? 2408 0.037 ? ? 1.694 8.80 100.00 ? ? ? 8 2.62 3.29 ? ? 2435 0.034 ? ? 1.803 8.80 100.00 ? ? ? 9 3.29 30.00 ? ? 2536 0.03 ? ? 1.805 8.50 99.10 ? ? ? 10 # _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. ARP/WARP WAS ALSO USED FOR STRUCTURE REFINEMENT' _refine.B_iso_mean 8.160 _refine.aniso_B[1][1] -0.293 _refine.aniso_B[2][2] 0.166 _refine.aniso_B[3][3] 0.127 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.ls_d_res_high 1.530 _refine.ls_d_res_low 28.25 _refine.ls_number_reflns_R_free 1069 _refine.ls_number_reflns_obs 21035 _refine.ls_R_factor_R_work 0.1533 _refine.ls_R_factor_R_free 0.1854 _refine.ls_R_factor_all 0.155 _refine.ls_wR_factor_R_work 0.164 _refine.ls_wR_factor_R_free 0.194 _refine.ls_percent_reflns_obs 88.349 _refine.ls_percent_reflns_R_free 5.082 _refine.correlation_coeff_Fo_to_Fc 0.962 _refine.correlation_coeff_Fo_to_Fc_free 0.941 _refine.pdbx_overall_ESU_R 0.088 _refine.pdbx_overall_ESU_R_Free 0.087 _refine.overall_SU_ML 0.040 _refine.overall_SU_B 1.030 _refine.entry_id 2GF9 _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_obs ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'pdb entry 3RAB' _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1438 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.number_atoms_solvent 184 _refine_hist.number_atoms_total 1653 _refine_hist.d_res_high 1.530 _refine_hist.d_res_low 28.25 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 1501 0.015 0.022 ? 'X-RAY DIFFRACTION' ? r_bond_other_d 1009 0.005 0.020 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2041 1.344 1.967 ? 'X-RAY DIFFRACTION' ? r_angle_other_deg 2443 0.874 3.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 183 5.382 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 75 36.992 23.867 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 256 11.213 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 11 11.515 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 222 0.078 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 1673 0.005 0.020 ? 'X-RAY DIFFRACTION' ? r_gen_planes_other 335 0.001 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 267 0.213 0.200 ? 'X-RAY DIFFRACTION' ? r_nbd_other 1066 0.193 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 759 0.181 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_other 754 0.085 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 130 0.116 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 7 0.120 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 68 0.333 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 28 0.127 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 961 1.756 2.000 ? 'X-RAY DIFFRACTION' ? r_mcbond_other 362 0.454 2.000 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1429 2.418 3.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 698 2.183 2.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 608 3.251 3.000 ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_low _refine_ls_shell.d_res_high _refine_ls_shell.number_reflns_all _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free _refine_ls_shell.number_reflns_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id 20 1.570 1.530 1739 21.507 350 0.214 0.212 24 0.192 . . . . 'X-RAY DIFFRACTION' 20 1.613 1.570 1685 54.837 875 0.18 0.181 49 0.196 . . . . 'X-RAY DIFFRACTION' 20 1.659 1.613 1621 73.288 1124 0.158 0.161 64 0.213 . . . . 'X-RAY DIFFRACTION' 20 1.710 1.659 1601 88.570 1352 0.145 0.148 66 0.213 . . . . 'X-RAY DIFFRACTION' 20 1.766 1.710 1544 99.223 1450 0.142 0.143 82 0.178 . . . . 'X-RAY DIFFRACTION' 20 1.828 1.766 1504 100.000 1435 0.14 0.141 69 0.161 . . . . 'X-RAY DIFFRACTION' 20 1.897 1.828 1442 100.000 1371 0.144 0.146 71 0.194 . . . . 'X-RAY DIFFRACTION' 20 1.974 1.897 1406 100.000 1318 0.145 0.150 88 0.22 . . . . 'X-RAY DIFFRACTION' 20 2.061 1.974 1322 100.000 1255 0.141 0.143 67 0.193 . . . . 'X-RAY DIFFRACTION' 20 2.161 2.061 1284 100.000 1224 0.142 0.143 60 0.164 . . . . 'X-RAY DIFFRACTION' 20 2.278 2.161 1231 99.919 1174 0.14 0.141 56 0.173 . . . . 'X-RAY DIFFRACTION' 20 2.415 2.278 1166 99.914 1098 0.14 0.141 67 0.169 . . . . 'X-RAY DIFFRACTION' 20 2.580 2.415 1106 100.000 1052 0.149 0.149 54 0.165 . . . . 'X-RAY DIFFRACTION' 20 2.785 2.580 1021 100.000 952 0.166 0.165 69 0.153 . . . . 'X-RAY DIFFRACTION' 20 3.049 2.785 948 100.000 911 0.165 0.166 37 0.193 . . . . 'X-RAY DIFFRACTION' 20 3.404 3.049 871 100.000 825 0.156 0.158 46 0.192 . . . . 'X-RAY DIFFRACTION' 20 3.922 3.404 779 99.872 751 0.151 0.151 27 0.168 . . . . 'X-RAY DIFFRACTION' 20 4.783 3.922 666 100.000 635 0.144 0.147 31 0.232 . . . . 'X-RAY DIFFRACTION' 20 6.680 4.783 538 99.814 507 0.198 0.196 30 0.158 . . . . 'X-RAY DIFFRACTION' 20 30.000 6.680 335 95.224 307 0.222 0.225 12 0.297 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 2GF9 _struct.title 'Crystal structure of human RAB3D in complex with GDP' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.text 'G-PROTEIN, RAB, Structural Genomics, Structural Genomics Consortium, SGC, PROTEIN TRANSPORT' _struct_keywords.entry_id 2GF9 _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 _struct_biol.details 'not known' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 34 ? ASP A 45 ? GLY A 34 ASP A 45 1 ? 12 HELX_P HELX_P2 2 ILE A 87 ? ARG A 93 ? ILE A 87 ARG A 93 5 ? 7 HELX_P HELX_P3 3 ASN A 106 ? ALA A 112 ? ASN A 106 ALA A 112 1 ? 7 HELX_P HELX_P4 4 ALA A 112 ? SER A 124 ? ALA A 112 SER A 124 1 ? 13 HELX_P HELX_P5 5 LEU A 139 ? ARG A 143 ? LEU A 139 ARG A 143 5 ? 5 HELX_P HELX_P6 6 PRO A 146 ? GLY A 158 ? PRO A 146 GLY A 158 1 ? 13 HELX_P HELX_P7 7 ASN A 171 ? ASN A 188 ? ASN A 171 ASN A 188 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A THR 36 OG1 ? ? ? 1_555 B MG . MG ? ? A THR 36 A MG 201 1_555 ? ? ? ? ? ? ? 2.082 ? ? metalc2 metalc ? ? B MG . MG ? ? ? 1_555 E GDP . O1B ? ? A MG 201 A GDP 501 1_555 ? ? ? ? ? ? ? 2.013 ? ? metalc3 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 201 A HOH 1017 1_555 ? ? ? ? ? ? ? 2.124 ? ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 201 A HOH 1030 1_555 ? ? ? ? ? ? ? 2.184 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 201 A HOH 1054 1_555 ? ? ? ? ? ? ? 2.133 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 201 A HOH 1056 1_555 ? ? ? ? ? ? ? 2.055 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 58 ? ARG A 66 ? ASP A 58 ARG A 66 A 2 LYS A 69 ? ASP A 77 ? LYS A 69 ASP A 77 A 3 TYR A 21 ? ILE A 28 ? TYR A 21 ILE A 28 A 4 GLY A 97 ? ASP A 103 ? GLY A 97 ASP A 103 A 5 GLN A 129 ? ASN A 135 ? GLN A 129 ASN A 135 A 6 GLU A 160 ? GLU A 163 ? GLU A 160 GLU A 163 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 62 ? N LYS A 62 O LEU A 73 ? O LEU A 73 A 2 3 O TRP A 76 ? O TRP A 76 N LEU A 25 ? N LEU A 25 A 3 4 N ILE A 28 ? N ILE A 28 O LEU A 99 ? O LEU A 99 A 4 5 N LEU A 100 ? N LEU A 100 O ILE A 131 ? O ILE A 131 A 5 6 N LEU A 132 ? N LEU A 132 O GLU A 160 ? O GLU A 160 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 201 ? 6 'BINDING SITE FOR RESIDUE MG A 201' AC2 Software A UNX 301 ? 1 'BINDING SITE FOR RESIDUE UNX A 301' AC3 Software A UNX 302 ? 6 'BINDING SITE FOR RESIDUE UNX A 302' AC4 Software A GDP 501 ? 27 'BINDING SITE FOR RESIDUE GDP A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 THR A 36 ? THR A 36 . ? 1_555 ? 2 AC1 6 GDP E . ? GDP A 501 . ? 1_555 ? 3 AC1 6 HOH F . ? HOH A 1017 . ? 1_555 ? 4 AC1 6 HOH F . ? HOH A 1030 . ? 1_555 ? 5 AC1 6 HOH F . ? HOH A 1054 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 1056 . ? 1_555 ? 7 AC2 1 CYS A 184 ? CYS A 184 . ? 1_555 ? 8 AC3 6 ARG A 17 ? ARG A 17 . ? 2_554 ? 9 AC3 6 SER A 46 ? SER A 46 . ? 1_555 ? 10 AC3 6 PHE A 47 ? PHE A 47 . ? 1_555 ? 11 AC3 6 THR A 86 ? THR A 86 . ? 3_545 ? 12 AC3 6 HOH F . ? HOH A 1068 . ? 2_554 ? 13 AC3 6 HOH F . ? HOH A 1109 . ? 3_645 ? 14 AC4 27 SER A 32 ? SER A 32 . ? 1_555 ? 15 AC4 27 VAL A 33 ? VAL A 33 . ? 1_555 ? 16 AC4 27 GLY A 34 ? GLY A 34 . ? 1_555 ? 17 AC4 27 LYS A 35 ? LYS A 35 . ? 1_555 ? 18 AC4 27 THR A 36 ? THR A 36 . ? 1_555 ? 19 AC4 27 SER A 37 ? SER A 37 . ? 1_555 ? 20 AC4 27 PHE A 47 ? PHE A 47 . ? 1_555 ? 21 AC4 27 ASN A 135 ? ASN A 135 . ? 1_555 ? 22 AC4 27 LYS A 136 ? LYS A 136 . ? 1_555 ? 23 AC4 27 ASP A 138 ? ASP A 138 . ? 1_555 ? 24 AC4 27 LEU A 139 ? LEU A 139 . ? 1_555 ? 25 AC4 27 GLU A 148 ? GLU A 148 . ? 4_455 ? 26 AC4 27 SER A 165 ? SER A 165 . ? 1_555 ? 27 AC4 27 ALA A 166 ? ALA A 166 . ? 1_555 ? 28 AC4 27 LYS A 167 ? LYS A 167 . ? 1_555 ? 29 AC4 27 MG B . ? MG A 201 . ? 1_555 ? 30 AC4 27 HOH F . ? HOH A 1005 . ? 1_555 ? 31 AC4 27 HOH F . ? HOH A 1007 . ? 1_555 ? 32 AC4 27 HOH F . ? HOH A 1012 . ? 4_455 ? 33 AC4 27 HOH F . ? HOH A 1017 . ? 1_555 ? 34 AC4 27 HOH F . ? HOH A 1035 . ? 1_555 ? 35 AC4 27 HOH F . ? HOH A 1041 . ? 1_555 ? 36 AC4 27 HOH F . ? HOH A 1047 . ? 4_455 ? 37 AC4 27 HOH F . ? HOH A 1054 . ? 1_555 ? 38 AC4 27 HOH F . ? HOH A 1055 . ? 4_455 ? 39 AC4 27 HOH F . ? HOH A 1056 . ? 1_555 ? 40 AC4 27 HOH F . ? HOH A 1065 . ? 1_555 ? # _atom_sites.entry_id 2GF9 _atom_sites.fract_transf_matrix[1][1] 0.02801 _atom_sites.fract_transf_matrix[1][2] 0.00000 _atom_sites.fract_transf_matrix[1][3] 0.00000 _atom_sites.fract_transf_matrix[2][1] 0.00000 _atom_sites.fract_transf_matrix[2][2] 0.01582 _atom_sites.fract_transf_matrix[2][3] 0.00000 _atom_sites.fract_transf_matrix[3][1] 0.00000 _atom_sites.fract_transf_matrix[3][2] 0.00000 _atom_sites.fract_transf_matrix[3][3] 0.01477 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S X # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 HIS 9 9 ? ? ? A . n A 1 10 HIS 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 GLY 13 13 ? ? ? A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 MET 96 96 96 MET MET A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 MET 101 101 101 MET MET A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 TRP 116 116 116 TRP TRP A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 TRP 125 125 125 TRP TRP A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 CYS 137 137 137 CYS CYS A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ASP 155 155 155 ASP ASP A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 ASN 169 169 169 ASN ASN A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 LYS 173 173 173 LYS LYS A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 ARG 178 178 178 ARG ARG A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 CYS 184 184 184 CYS CYS A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 MET 187 187 187 MET MET A . n A 1 188 ASN 188 188 188 ASN ASN A . n A 1 189 GLU 189 189 189 GLU GLU A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium' _pdbx_SG_project.initial_of_center SGC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 201 201 MG MG A . C 3 UNX 1 301 301 UNX UNX A . D 3 UNX 1 302 302 UNX UNX A . E 4 GDP 1 501 501 GDP GDP A . F 5 HOH 1 1001 1001 HOH HOH A . F 5 HOH 2 1002 1002 HOH HOH A . F 5 HOH 3 1003 1003 HOH HOH A . F 5 HOH 4 1004 1004 HOH HOH A . F 5 HOH 5 1005 1005 HOH HOH A . F 5 HOH 6 1006 1006 HOH HOH A . F 5 HOH 7 1007 1007 HOH HOH A . F 5 HOH 8 1008 1008 HOH HOH A . F 5 HOH 9 1009 1009 HOH HOH A . F 5 HOH 10 1010 1010 HOH HOH A . F 5 HOH 11 1011 1011 HOH HOH A . F 5 HOH 12 1012 1012 HOH HOH A . F 5 HOH 13 1013 1013 HOH HOH A . F 5 HOH 14 1014 1014 HOH HOH A . F 5 HOH 15 1015 1015 HOH HOH A . F 5 HOH 16 1016 1016 HOH HOH A . F 5 HOH 17 1017 1017 HOH HOH A . F 5 HOH 18 1018 1018 HOH HOH A . F 5 HOH 19 1019 1019 HOH HOH A . F 5 HOH 20 1020 1020 HOH HOH A . F 5 HOH 21 1021 1021 HOH HOH A . F 5 HOH 22 1022 1022 HOH HOH A . F 5 HOH 23 1023 1023 HOH HOH A . F 5 HOH 24 1024 1024 HOH HOH A . F 5 HOH 25 1025 1025 HOH HOH A . F 5 HOH 26 1026 1026 HOH HOH A . F 5 HOH 27 1027 1027 HOH HOH A . F 5 HOH 28 1028 1028 HOH HOH A . F 5 HOH 29 1029 1029 HOH HOH A . F 5 HOH 30 1030 1030 HOH HOH A . F 5 HOH 31 1031 1031 HOH HOH A . F 5 HOH 32 1032 1032 HOH HOH A . F 5 HOH 33 1033 1033 HOH HOH A . F 5 HOH 34 1034 1034 HOH HOH A . F 5 HOH 35 1035 1035 HOH HOH A . F 5 HOH 36 1036 1036 HOH HOH A . F 5 HOH 37 1037 1037 HOH HOH A . F 5 HOH 38 1038 1038 HOH HOH A . F 5 HOH 39 1039 1039 HOH HOH A . F 5 HOH 40 1040 1040 HOH HOH A . F 5 HOH 41 1041 1041 HOH HOH A . F 5 HOH 42 1042 1042 HOH HOH A . F 5 HOH 43 1043 1043 HOH HOH A . F 5 HOH 44 1044 1044 HOH HOH A . F 5 HOH 45 1045 1045 HOH HOH A . F 5 HOH 46 1046 1046 HOH HOH A . F 5 HOH 47 1047 1047 HOH HOH A . F 5 HOH 48 1048 1048 HOH HOH A . F 5 HOH 49 1049 1049 HOH HOH A . F 5 HOH 50 1050 1050 HOH HOH A . F 5 HOH 51 1051 1051 HOH HOH A . F 5 HOH 52 1052 1052 HOH HOH A . F 5 HOH 53 1053 1053 HOH HOH A . F 5 HOH 54 1054 1054 HOH HOH A . F 5 HOH 55 1055 1055 HOH HOH A . F 5 HOH 56 1056 1056 HOH HOH A . F 5 HOH 57 1057 1057 HOH HOH A . F 5 HOH 58 1058 1058 HOH HOH A . F 5 HOH 59 1059 1059 HOH HOH A . F 5 HOH 60 1060 1060 HOH HOH A . F 5 HOH 61 1061 1061 HOH HOH A . F 5 HOH 62 1062 1062 HOH HOH A . F 5 HOH 63 1063 1063 HOH HOH A . F 5 HOH 64 1064 1064 HOH HOH A . F 5 HOH 65 1065 1065 HOH HOH A . F 5 HOH 66 1066 1066 HOH HOH A . F 5 HOH 67 1067 1067 HOH HOH A . F 5 HOH 68 1068 1068 HOH HOH A . F 5 HOH 69 1069 1069 HOH HOH A . F 5 HOH 70 1070 1070 HOH HOH A . F 5 HOH 71 1071 1071 HOH HOH A . F 5 HOH 72 1072 1072 HOH HOH A . F 5 HOH 73 1073 1073 HOH HOH A . F 5 HOH 74 1074 1074 HOH HOH A . F 5 HOH 75 1075 1075 HOH HOH A . F 5 HOH 76 1076 1076 HOH HOH A . F 5 HOH 77 1077 1077 HOH HOH A . F 5 HOH 78 1078 1078 HOH HOH A . F 5 HOH 79 1079 1079 HOH HOH A . F 5 HOH 80 1080 1080 HOH HOH A . F 5 HOH 81 1081 1081 HOH HOH A . F 5 HOH 82 1082 1082 HOH HOH A . F 5 HOH 83 1083 1083 HOH HOH A . F 5 HOH 84 1084 1084 HOH HOH A . F 5 HOH 85 1085 1085 HOH HOH A . F 5 HOH 86 1086 1086 HOH HOH A . F 5 HOH 87 1087 1087 HOH HOH A . F 5 HOH 88 1088 1088 HOH HOH A . F 5 HOH 89 1089 1089 HOH HOH A . F 5 HOH 90 1090 1090 HOH HOH A . F 5 HOH 91 1091 1091 HOH HOH A . F 5 HOH 92 1092 1092 HOH HOH A . F 5 HOH 93 1093 1093 HOH HOH A . F 5 HOH 94 1094 1094 HOH HOH A . F 5 HOH 95 1095 1095 HOH HOH A . F 5 HOH 96 1096 1096 HOH HOH A . F 5 HOH 97 1097 1097 HOH HOH A . F 5 HOH 98 1098 1098 HOH HOH A . F 5 HOH 99 1099 1099 HOH HOH A . F 5 HOH 100 1100 1100 HOH HOH A . F 5 HOH 101 1101 1101 HOH HOH A . F 5 HOH 102 1102 1102 HOH HOH A . F 5 HOH 103 1103 1103 HOH HOH A . F 5 HOH 104 1104 1104 HOH HOH A . F 5 HOH 105 1105 1105 HOH HOH A . F 5 HOH 106 1106 1106 HOH HOH A . F 5 HOH 107 1107 1107 HOH HOH A . F 5 HOH 108 1108 1108 HOH HOH A . F 5 HOH 109 1109 1109 HOH HOH A . F 5 HOH 110 1110 1110 HOH HOH A . F 5 HOH 111 1111 1111 HOH HOH A . F 5 HOH 112 1112 1112 HOH HOH A . F 5 HOH 113 1113 1113 HOH HOH A . F 5 HOH 114 1114 1114 HOH HOH A . F 5 HOH 115 1115 1115 HOH HOH A . F 5 HOH 116 1116 1116 HOH HOH A . F 5 HOH 117 1117 1117 HOH HOH A . F 5 HOH 118 1118 1118 HOH HOH A . F 5 HOH 119 1119 1119 HOH HOH A . F 5 HOH 120 1120 1120 HOH HOH A . F 5 HOH 121 1121 1121 HOH HOH A . F 5 HOH 122 1122 1122 HOH HOH A . F 5 HOH 123 1123 1123 HOH HOH A . F 5 HOH 124 1124 1124 HOH HOH A . F 5 HOH 125 1125 1125 HOH HOH A . F 5 HOH 126 1126 1126 HOH HOH A . F 5 HOH 127 1127 1127 HOH HOH A . F 5 HOH 128 1128 1128 HOH HOH A . F 5 HOH 129 1129 1129 HOH HOH A . F 5 HOH 130 1130 1130 HOH HOH A . F 5 HOH 131 1131 1131 HOH HOH A . F 5 HOH 132 1132 1132 HOH HOH A . F 5 HOH 133 1133 1133 HOH HOH A . F 5 HOH 134 1134 1134 HOH HOH A . F 5 HOH 135 1135 1135 HOH HOH A . F 5 HOH 136 1136 1136 HOH HOH A . F 5 HOH 137 1137 1137 HOH HOH A . F 5 HOH 138 1138 1138 HOH HOH A . F 5 HOH 139 1139 1139 HOH HOH A . F 5 HOH 140 1140 1140 HOH HOH A . F 5 HOH 141 1141 1141 HOH HOH A . F 5 HOH 142 1142 1142 HOH HOH A . F 5 HOH 143 1143 1143 HOH HOH A . F 5 HOH 144 1144 1144 HOH HOH A . F 5 HOH 145 1145 1145 HOH HOH A . F 5 HOH 146 1146 1146 HOH HOH A . F 5 HOH 147 1147 1147 HOH HOH A . F 5 HOH 148 1148 1148 HOH HOH A . F 5 HOH 149 1149 1149 HOH HOH A . F 5 HOH 150 1150 1150 HOH HOH A . F 5 HOH 151 1151 1151 HOH HOH A . F 5 HOH 152 1152 1152 HOH HOH A . F 5 HOH 153 1153 1153 HOH HOH A . F 5 HOH 154 1154 1154 HOH HOH A . F 5 HOH 155 1155 1155 HOH HOH A . F 5 HOH 156 1156 1156 HOH HOH A . F 5 HOH 157 1157 1157 HOH HOH A . F 5 HOH 158 1158 1158 HOH HOH A . F 5 HOH 159 1159 1159 HOH HOH A . F 5 HOH 160 1160 1160 HOH HOH A . F 5 HOH 161 1161 1161 HOH HOH A . F 5 HOH 162 1162 1162 HOH HOH A . F 5 HOH 163 1163 1163 HOH HOH A . F 5 HOH 164 1164 1164 HOH HOH A . F 5 HOH 165 1165 1165 HOH HOH A . F 5 HOH 166 1166 1166 HOH HOH A . F 5 HOH 167 1167 1167 HOH HOH A . F 5 HOH 168 1168 1168 HOH HOH A . F 5 HOH 169 1169 1169 HOH HOH A . F 5 HOH 170 1170 1170 HOH HOH A . F 5 HOH 171 1171 1171 HOH HOH A . F 5 HOH 172 1172 1172 HOH HOH A . F 5 HOH 173 1173 1173 HOH HOH A . F 5 HOH 174 1174 1174 HOH HOH A . F 5 HOH 175 1175 1175 HOH HOH A . F 5 HOH 176 1176 1176 HOH HOH A . F 5 HOH 177 1177 1177 HOH HOH A . F 5 HOH 178 1178 1178 HOH HOH A . F 5 HOH 179 1179 1179 HOH HOH A . F 5 HOH 180 1180 1180 HOH HOH A . F 5 HOH 181 1181 1181 HOH HOH A . F 5 HOH 182 1182 1182 HOH HOH A . F 5 HOH 183 1183 1183 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OG1 ? A THR 36 ? A THR 36 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O1B ? E GDP . ? A GDP 501 ? 1_555 92.0 ? 2 OG1 ? A THR 36 ? A THR 36 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 1017 ? 1_555 88.5 ? 3 O1B ? E GDP . ? A GDP 501 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 1017 ? 1_555 90.7 ? 4 OG1 ? A THR 36 ? A THR 36 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 1030 ? 1_555 87.7 ? 5 O1B ? E GDP . ? A GDP 501 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 1030 ? 1_555 177.8 ? 6 O ? F HOH . ? A HOH 1017 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 1030 ? 1_555 91.5 ? 7 OG1 ? A THR 36 ? A THR 36 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 1054 ? 1_555 173.5 ? 8 O1B ? E GDP . ? A GDP 501 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 1054 ? 1_555 92.8 ? 9 O ? F HOH . ? A HOH 1017 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 1054 ? 1_555 87.0 ? 10 O ? F HOH . ? A HOH 1030 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 1054 ? 1_555 87.7 ? 11 OG1 ? A THR 36 ? A THR 36 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 1056 ? 1_555 93.0 ? 12 O1B ? E GDP . ? A GDP 501 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 1056 ? 1_555 90.7 ? 13 O ? F HOH . ? A HOH 1017 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 1056 ? 1_555 177.9 ? 14 O ? F HOH . ? A HOH 1030 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 1056 ? 1_555 87.2 ? 15 O ? F HOH . ? A HOH 1054 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? F HOH . ? A HOH 1056 ? 1_555 91.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-05-02 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-18 5 'Structure model' 1 4 2023-08-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Refinement description' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' chem_comp_atom 3 5 'Structure model' chem_comp_bond 4 5 'Structure model' database_2 5 5 'Structure model' pdbx_initial_refinement_model 6 5 'Structure model' pdbx_struct_conn_angle 7 5 'Structure model' struct_conn 8 5 'Structure model' struct_ref_seq_dif 9 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.contact_author' 3 4 'Structure model' '_software.contact_author_email' 4 4 'Structure model' '_software.date' 5 4 'Structure model' '_software.language' 6 4 'Structure model' '_software.location' 7 4 'Structure model' '_software.name' 8 4 'Structure model' '_software.type' 9 4 'Structure model' '_software.version' 10 5 'Structure model' '_database_2.pdbx_DOI' 11 5 'Structure model' '_database_2.pdbx_database_accession' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 18 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 19 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 20 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 21 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 22 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 23 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 24 5 'Structure model' '_pdbx_struct_conn_angle.value' 25 5 'Structure model' '_struct_conn.pdbx_dist_value' 26 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 27 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 28 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 29 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 30 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 31 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 32 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 33 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 34 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 35 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 36 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 37 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 38 5 'Structure model' '_struct_ref_seq_dif.details' 39 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 40 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 41 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_phasing_MR.entry_id 2GF9 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.500 _pdbx_phasing_MR.d_res_low_rotation 28.250 _pdbx_phasing_MR.d_res_high_translation 2.500 _pdbx_phasing_MR.d_res_low_translation 28.250 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method mr # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal DENZO . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data reduction' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data scaling' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 2 PHASER . ? program 'R. J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 3 REFMAC refmac_5.2.0019 24/04/2001 program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran ? 4 PDB_EXTRACT 1.701 'Nov. 1, 2005' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 5 # _pdbx_database_remark.id 300 _pdbx_database_remark.text ;BIOMOLECULE THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT WHICH CONSISTS OF 1 CHAIN. ACCORDING TO AUTHORS, THE BIOLOGICAL UNIT OF THE PROTEIN IS NOT KNOWN ; # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 SG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 CYS _pdbx_validate_close_contact.auth_seq_id_1 184 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 UNK _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 UNX _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.11 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 49 ? ? -85.99 42.31 2 1 ALA A 79 ? ? 63.16 -139.30 3 1 LEU A 139 ? ? -90.55 46.74 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 68 ? CG ? A ASP 68 CG 2 1 Y 1 A ASP 68 ? OD1 ? A ASP 68 OD1 3 1 Y 1 A ASP 68 ? OD2 ? A ASP 68 OD2 4 1 Y 1 A LYS 69 ? CD ? A LYS 69 CD 5 1 Y 1 A LYS 69 ? CE ? A LYS 69 CE 6 1 Y 1 A LYS 69 ? NZ ? A LYS 69 NZ 7 1 Y 1 A LYS 173 ? CG ? A LYS 173 CG 8 1 Y 1 A LYS 173 ? CD ? A LYS 173 CD 9 1 Y 1 A LYS 173 ? CE ? A LYS 173 CE 10 1 Y 1 A LYS 173 ? NZ ? A LYS 173 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A HIS 9 ? A HIS 9 10 1 Y 1 A HIS 10 ? A HIS 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A GLY 13 ? A GLY 13 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GDP PB P N N 88 GDP O1B O N N 89 GDP O2B O N N 90 GDP O3B O N N 91 GDP O3A O N N 92 GDP PA P N N 93 GDP O1A O N N 94 GDP O2A O N N 95 GDP "O5'" O N N 96 GDP "C5'" C N N 97 GDP "C4'" C N R 98 GDP "O4'" O N N 99 GDP "C3'" C N S 100 GDP "O3'" O N N 101 GDP "C2'" C N R 102 GDP "O2'" O N N 103 GDP "C1'" C N R 104 GDP N9 N Y N 105 GDP C8 C Y N 106 GDP N7 N Y N 107 GDP C5 C Y N 108 GDP C6 C N N 109 GDP O6 O N N 110 GDP N1 N N N 111 GDP C2 C N N 112 GDP N2 N N N 113 GDP N3 N N N 114 GDP C4 C Y N 115 GDP HOB2 H N N 116 GDP HOB3 H N N 117 GDP HOA2 H N N 118 GDP "H5'" H N N 119 GDP "H5''" H N N 120 GDP "H4'" H N N 121 GDP "H3'" H N N 122 GDP "HO3'" H N N 123 GDP "H2'" H N N 124 GDP "HO2'" H N N 125 GDP "H1'" H N N 126 GDP H8 H N N 127 GDP HN1 H N N 128 GDP HN21 H N N 129 GDP HN22 H N N 130 GLN N N N N 131 GLN CA C N S 132 GLN C C N N 133 GLN O O N N 134 GLN CB C N N 135 GLN CG C N N 136 GLN CD C N N 137 GLN OE1 O N N 138 GLN NE2 N N N 139 GLN OXT O N N 140 GLN H H N N 141 GLN H2 H N N 142 GLN HA H N N 143 GLN HB2 H N N 144 GLN HB3 H N N 145 GLN HG2 H N N 146 GLN HG3 H N N 147 GLN HE21 H N N 148 GLN HE22 H N N 149 GLN HXT H N N 150 GLU N N N N 151 GLU CA C N S 152 GLU C C N N 153 GLU O O N N 154 GLU CB C N N 155 GLU CG C N N 156 GLU CD C N N 157 GLU OE1 O N N 158 GLU OE2 O N N 159 GLU OXT O N N 160 GLU H H N N 161 GLU H2 H N N 162 GLU HA H N N 163 GLU HB2 H N N 164 GLU HB3 H N N 165 GLU HG2 H N N 166 GLU HG3 H N N 167 GLU HE2 H N N 168 GLU HXT H N N 169 GLY N N N N 170 GLY CA C N N 171 GLY C C N N 172 GLY O O N N 173 GLY OXT O N N 174 GLY H H N N 175 GLY H2 H N N 176 GLY HA2 H N N 177 GLY HA3 H N N 178 GLY HXT H N N 179 HIS N N N N 180 HIS CA C N S 181 HIS C C N N 182 HIS O O N N 183 HIS CB C N N 184 HIS CG C Y N 185 HIS ND1 N Y N 186 HIS CD2 C Y N 187 HIS CE1 C Y N 188 HIS NE2 N Y N 189 HIS OXT O N N 190 HIS H H N N 191 HIS H2 H N N 192 HIS HA H N N 193 HIS HB2 H N N 194 HIS HB3 H N N 195 HIS HD1 H N N 196 HIS HD2 H N N 197 HIS HE1 H N N 198 HIS HE2 H N N 199 HIS HXT H N N 200 HOH O O N N 201 HOH H1 H N N 202 HOH H2 H N N 203 ILE N N N N 204 ILE CA C N S 205 ILE C C N N 206 ILE O O N N 207 ILE CB C N S 208 ILE CG1 C N N 209 ILE CG2 C N N 210 ILE CD1 C N N 211 ILE OXT O N N 212 ILE H H N N 213 ILE H2 H N N 214 ILE HA H N N 215 ILE HB H N N 216 ILE HG12 H N N 217 ILE HG13 H N N 218 ILE HG21 H N N 219 ILE HG22 H N N 220 ILE HG23 H N N 221 ILE HD11 H N N 222 ILE HD12 H N N 223 ILE HD13 H N N 224 ILE HXT H N N 225 LEU N N N N 226 LEU CA C N S 227 LEU C C N N 228 LEU O O N N 229 LEU CB C N N 230 LEU CG C N N 231 LEU CD1 C N N 232 LEU CD2 C N N 233 LEU OXT O N N 234 LEU H H N N 235 LEU H2 H N N 236 LEU HA H N N 237 LEU HB2 H N N 238 LEU HB3 H N N 239 LEU HG H N N 240 LEU HD11 H N N 241 LEU HD12 H N N 242 LEU HD13 H N N 243 LEU HD21 H N N 244 LEU HD22 H N N 245 LEU HD23 H N N 246 LEU HXT H N N 247 LYS N N N N 248 LYS CA C N S 249 LYS C C N N 250 LYS O O N N 251 LYS CB C N N 252 LYS CG C N N 253 LYS CD C N N 254 LYS CE C N N 255 LYS NZ N N N 256 LYS OXT O N N 257 LYS H H N N 258 LYS H2 H N N 259 LYS HA H N N 260 LYS HB2 H N N 261 LYS HB3 H N N 262 LYS HG2 H N N 263 LYS HG3 H N N 264 LYS HD2 H N N 265 LYS HD3 H N N 266 LYS HE2 H N N 267 LYS HE3 H N N 268 LYS HZ1 H N N 269 LYS HZ2 H N N 270 LYS HZ3 H N N 271 LYS HXT H N N 272 MET N N N N 273 MET CA C N S 274 MET C C N N 275 MET O O N N 276 MET CB C N N 277 MET CG C N N 278 MET SD S N N 279 MET CE C N N 280 MET OXT O N N 281 MET H H N N 282 MET H2 H N N 283 MET HA H N N 284 MET HB2 H N N 285 MET HB3 H N N 286 MET HG2 H N N 287 MET HG3 H N N 288 MET HE1 H N N 289 MET HE2 H N N 290 MET HE3 H N N 291 MET HXT H N N 292 MG MG MG N N 293 PHE N N N N 294 PHE CA C N S 295 PHE C C N N 296 PHE O O N N 297 PHE CB C N N 298 PHE CG C Y N 299 PHE CD1 C Y N 300 PHE CD2 C Y N 301 PHE CE1 C Y N 302 PHE CE2 C Y N 303 PHE CZ C Y N 304 PHE OXT O N N 305 PHE H H N N 306 PHE H2 H N N 307 PHE HA H N N 308 PHE HB2 H N N 309 PHE HB3 H N N 310 PHE HD1 H N N 311 PHE HD2 H N N 312 PHE HE1 H N N 313 PHE HE2 H N N 314 PHE HZ H N N 315 PHE HXT H N N 316 PRO N N N N 317 PRO CA C N S 318 PRO C C N N 319 PRO O O N N 320 PRO CB C N N 321 PRO CG C N N 322 PRO CD C N N 323 PRO OXT O N N 324 PRO H H N N 325 PRO HA H N N 326 PRO HB2 H N N 327 PRO HB3 H N N 328 PRO HG2 H N N 329 PRO HG3 H N N 330 PRO HD2 H N N 331 PRO HD3 H N N 332 PRO HXT H N N 333 SER N N N N 334 SER CA C N S 335 SER C C N N 336 SER O O N N 337 SER CB C N N 338 SER OG O N N 339 SER OXT O N N 340 SER H H N N 341 SER H2 H N N 342 SER HA H N N 343 SER HB2 H N N 344 SER HB3 H N N 345 SER HG H N N 346 SER HXT H N N 347 THR N N N N 348 THR CA C N S 349 THR C C N N 350 THR O O N N 351 THR CB C N R 352 THR OG1 O N N 353 THR CG2 C N N 354 THR OXT O N N 355 THR H H N N 356 THR H2 H N N 357 THR HA H N N 358 THR HB H N N 359 THR HG1 H N N 360 THR HG21 H N N 361 THR HG22 H N N 362 THR HG23 H N N 363 THR HXT H N N 364 TRP N N N N 365 TRP CA C N S 366 TRP C C N N 367 TRP O O N N 368 TRP CB C N N 369 TRP CG C Y N 370 TRP CD1 C Y N 371 TRP CD2 C Y N 372 TRP NE1 N Y N 373 TRP CE2 C Y N 374 TRP CE3 C Y N 375 TRP CZ2 C Y N 376 TRP CZ3 C Y N 377 TRP CH2 C Y N 378 TRP OXT O N N 379 TRP H H N N 380 TRP H2 H N N 381 TRP HA H N N 382 TRP HB2 H N N 383 TRP HB3 H N N 384 TRP HD1 H N N 385 TRP HE1 H N N 386 TRP HE3 H N N 387 TRP HZ2 H N N 388 TRP HZ3 H N N 389 TRP HH2 H N N 390 TRP HXT H N N 391 TYR N N N N 392 TYR CA C N S 393 TYR C C N N 394 TYR O O N N 395 TYR CB C N N 396 TYR CG C Y N 397 TYR CD1 C Y N 398 TYR CD2 C Y N 399 TYR CE1 C Y N 400 TYR CE2 C Y N 401 TYR CZ C Y N 402 TYR OH O N N 403 TYR OXT O N N 404 TYR H H N N 405 TYR H2 H N N 406 TYR HA H N N 407 TYR HB2 H N N 408 TYR HB3 H N N 409 TYR HD1 H N N 410 TYR HD2 H N N 411 TYR HE1 H N N 412 TYR HE2 H N N 413 TYR HH H N N 414 TYR HXT H N N 415 VAL N N N N 416 VAL CA C N S 417 VAL C C N N 418 VAL O O N N 419 VAL CB C N N 420 VAL CG1 C N N 421 VAL CG2 C N N 422 VAL OXT O N N 423 VAL H H N N 424 VAL H2 H N N 425 VAL HA H N N 426 VAL HB H N N 427 VAL HG11 H N N 428 VAL HG12 H N N 429 VAL HG13 H N N 430 VAL HG21 H N N 431 VAL HG22 H N N 432 VAL HG23 H N N 433 VAL HXT H N N 434 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GDP PB O1B doub N N 83 GDP PB O2B sing N N 84 GDP PB O3B sing N N 85 GDP PB O3A sing N N 86 GDP O2B HOB2 sing N N 87 GDP O3B HOB3 sing N N 88 GDP O3A PA sing N N 89 GDP PA O1A doub N N 90 GDP PA O2A sing N N 91 GDP PA "O5'" sing N N 92 GDP O2A HOA2 sing N N 93 GDP "O5'" "C5'" sing N N 94 GDP "C5'" "C4'" sing N N 95 GDP "C5'" "H5'" sing N N 96 GDP "C5'" "H5''" sing N N 97 GDP "C4'" "O4'" sing N N 98 GDP "C4'" "C3'" sing N N 99 GDP "C4'" "H4'" sing N N 100 GDP "O4'" "C1'" sing N N 101 GDP "C3'" "O3'" sing N N 102 GDP "C3'" "C2'" sing N N 103 GDP "C3'" "H3'" sing N N 104 GDP "O3'" "HO3'" sing N N 105 GDP "C2'" "O2'" sing N N 106 GDP "C2'" "C1'" sing N N 107 GDP "C2'" "H2'" sing N N 108 GDP "O2'" "HO2'" sing N N 109 GDP "C1'" N9 sing N N 110 GDP "C1'" "H1'" sing N N 111 GDP N9 C8 sing Y N 112 GDP N9 C4 sing Y N 113 GDP C8 N7 doub Y N 114 GDP C8 H8 sing N N 115 GDP N7 C5 sing Y N 116 GDP C5 C6 sing N N 117 GDP C5 C4 doub Y N 118 GDP C6 O6 doub N N 119 GDP C6 N1 sing N N 120 GDP N1 C2 sing N N 121 GDP N1 HN1 sing N N 122 GDP C2 N2 sing N N 123 GDP C2 N3 doub N N 124 GDP N2 HN21 sing N N 125 GDP N2 HN22 sing N N 126 GDP N3 C4 sing N N 127 GLN N CA sing N N 128 GLN N H sing N N 129 GLN N H2 sing N N 130 GLN CA C sing N N 131 GLN CA CB sing N N 132 GLN CA HA sing N N 133 GLN C O doub N N 134 GLN C OXT sing N N 135 GLN CB CG sing N N 136 GLN CB HB2 sing N N 137 GLN CB HB3 sing N N 138 GLN CG CD sing N N 139 GLN CG HG2 sing N N 140 GLN CG HG3 sing N N 141 GLN CD OE1 doub N N 142 GLN CD NE2 sing N N 143 GLN NE2 HE21 sing N N 144 GLN NE2 HE22 sing N N 145 GLN OXT HXT sing N N 146 GLU N CA sing N N 147 GLU N H sing N N 148 GLU N H2 sing N N 149 GLU CA C sing N N 150 GLU CA CB sing N N 151 GLU CA HA sing N N 152 GLU C O doub N N 153 GLU C OXT sing N N 154 GLU CB CG sing N N 155 GLU CB HB2 sing N N 156 GLU CB HB3 sing N N 157 GLU CG CD sing N N 158 GLU CG HG2 sing N N 159 GLU CG HG3 sing N N 160 GLU CD OE1 doub N N 161 GLU CD OE2 sing N N 162 GLU OE2 HE2 sing N N 163 GLU OXT HXT sing N N 164 GLY N CA sing N N 165 GLY N H sing N N 166 GLY N H2 sing N N 167 GLY CA C sing N N 168 GLY CA HA2 sing N N 169 GLY CA HA3 sing N N 170 GLY C O doub N N 171 GLY C OXT sing N N 172 GLY OXT HXT sing N N 173 HIS N CA sing N N 174 HIS N H sing N N 175 HIS N H2 sing N N 176 HIS CA C sing N N 177 HIS CA CB sing N N 178 HIS CA HA sing N N 179 HIS C O doub N N 180 HIS C OXT sing N N 181 HIS CB CG sing N N 182 HIS CB HB2 sing N N 183 HIS CB HB3 sing N N 184 HIS CG ND1 sing Y N 185 HIS CG CD2 doub Y N 186 HIS ND1 CE1 doub Y N 187 HIS ND1 HD1 sing N N 188 HIS CD2 NE2 sing Y N 189 HIS CD2 HD2 sing N N 190 HIS CE1 NE2 sing Y N 191 HIS CE1 HE1 sing N N 192 HIS NE2 HE2 sing N N 193 HIS OXT HXT sing N N 194 HOH O H1 sing N N 195 HOH O H2 sing N N 196 ILE N CA sing N N 197 ILE N H sing N N 198 ILE N H2 sing N N 199 ILE CA C sing N N 200 ILE CA CB sing N N 201 ILE CA HA sing N N 202 ILE C O doub N N 203 ILE C OXT sing N N 204 ILE CB CG1 sing N N 205 ILE CB CG2 sing N N 206 ILE CB HB sing N N 207 ILE CG1 CD1 sing N N 208 ILE CG1 HG12 sing N N 209 ILE CG1 HG13 sing N N 210 ILE CG2 HG21 sing N N 211 ILE CG2 HG22 sing N N 212 ILE CG2 HG23 sing N N 213 ILE CD1 HD11 sing N N 214 ILE CD1 HD12 sing N N 215 ILE CD1 HD13 sing N N 216 ILE OXT HXT sing N N 217 LEU N CA sing N N 218 LEU N H sing N N 219 LEU N H2 sing N N 220 LEU CA C sing N N 221 LEU CA CB sing N N 222 LEU CA HA sing N N 223 LEU C O doub N N 224 LEU C OXT sing N N 225 LEU CB CG sing N N 226 LEU CB HB2 sing N N 227 LEU CB HB3 sing N N 228 LEU CG CD1 sing N N 229 LEU CG CD2 sing N N 230 LEU CG HG sing N N 231 LEU CD1 HD11 sing N N 232 LEU CD1 HD12 sing N N 233 LEU CD1 HD13 sing N N 234 LEU CD2 HD21 sing N N 235 LEU CD2 HD22 sing N N 236 LEU CD2 HD23 sing N N 237 LEU OXT HXT sing N N 238 LYS N CA sing N N 239 LYS N H sing N N 240 LYS N H2 sing N N 241 LYS CA C sing N N 242 LYS CA CB sing N N 243 LYS CA HA sing N N 244 LYS C O doub N N 245 LYS C OXT sing N N 246 LYS CB CG sing N N 247 LYS CB HB2 sing N N 248 LYS CB HB3 sing N N 249 LYS CG CD sing N N 250 LYS CG HG2 sing N N 251 LYS CG HG3 sing N N 252 LYS CD CE sing N N 253 LYS CD HD2 sing N N 254 LYS CD HD3 sing N N 255 LYS CE NZ sing N N 256 LYS CE HE2 sing N N 257 LYS CE HE3 sing N N 258 LYS NZ HZ1 sing N N 259 LYS NZ HZ2 sing N N 260 LYS NZ HZ3 sing N N 261 LYS OXT HXT sing N N 262 MET N CA sing N N 263 MET N H sing N N 264 MET N H2 sing N N 265 MET CA C sing N N 266 MET CA CB sing N N 267 MET CA HA sing N N 268 MET C O doub N N 269 MET C OXT sing N N 270 MET CB CG sing N N 271 MET CB HB2 sing N N 272 MET CB HB3 sing N N 273 MET CG SD sing N N 274 MET CG HG2 sing N N 275 MET CG HG3 sing N N 276 MET SD CE sing N N 277 MET CE HE1 sing N N 278 MET CE HE2 sing N N 279 MET CE HE3 sing N N 280 MET OXT HXT sing N N 281 PHE N CA sing N N 282 PHE N H sing N N 283 PHE N H2 sing N N 284 PHE CA C sing N N 285 PHE CA CB sing N N 286 PHE CA HA sing N N 287 PHE C O doub N N 288 PHE C OXT sing N N 289 PHE CB CG sing N N 290 PHE CB HB2 sing N N 291 PHE CB HB3 sing N N 292 PHE CG CD1 doub Y N 293 PHE CG CD2 sing Y N 294 PHE CD1 CE1 sing Y N 295 PHE CD1 HD1 sing N N 296 PHE CD2 CE2 doub Y N 297 PHE CD2 HD2 sing N N 298 PHE CE1 CZ doub Y N 299 PHE CE1 HE1 sing N N 300 PHE CE2 CZ sing Y N 301 PHE CE2 HE2 sing N N 302 PHE CZ HZ sing N N 303 PHE OXT HXT sing N N 304 PRO N CA sing N N 305 PRO N CD sing N N 306 PRO N H sing N N 307 PRO CA C sing N N 308 PRO CA CB sing N N 309 PRO CA HA sing N N 310 PRO C O doub N N 311 PRO C OXT sing N N 312 PRO CB CG sing N N 313 PRO CB HB2 sing N N 314 PRO CB HB3 sing N N 315 PRO CG CD sing N N 316 PRO CG HG2 sing N N 317 PRO CG HG3 sing N N 318 PRO CD HD2 sing N N 319 PRO CD HD3 sing N N 320 PRO OXT HXT sing N N 321 SER N CA sing N N 322 SER N H sing N N 323 SER N H2 sing N N 324 SER CA C sing N N 325 SER CA CB sing N N 326 SER CA HA sing N N 327 SER C O doub N N 328 SER C OXT sing N N 329 SER CB OG sing N N 330 SER CB HB2 sing N N 331 SER CB HB3 sing N N 332 SER OG HG sing N N 333 SER OXT HXT sing N N 334 THR N CA sing N N 335 THR N H sing N N 336 THR N H2 sing N N 337 THR CA C sing N N 338 THR CA CB sing N N 339 THR CA HA sing N N 340 THR C O doub N N 341 THR C OXT sing N N 342 THR CB OG1 sing N N 343 THR CB CG2 sing N N 344 THR CB HB sing N N 345 THR OG1 HG1 sing N N 346 THR CG2 HG21 sing N N 347 THR CG2 HG22 sing N N 348 THR CG2 HG23 sing N N 349 THR OXT HXT sing N N 350 TRP N CA sing N N 351 TRP N H sing N N 352 TRP N H2 sing N N 353 TRP CA C sing N N 354 TRP CA CB sing N N 355 TRP CA HA sing N N 356 TRP C O doub N N 357 TRP C OXT sing N N 358 TRP CB CG sing N N 359 TRP CB HB2 sing N N 360 TRP CB HB3 sing N N 361 TRP CG CD1 doub Y N 362 TRP CG CD2 sing Y N 363 TRP CD1 NE1 sing Y N 364 TRP CD1 HD1 sing N N 365 TRP CD2 CE2 doub Y N 366 TRP CD2 CE3 sing Y N 367 TRP NE1 CE2 sing Y N 368 TRP NE1 HE1 sing N N 369 TRP CE2 CZ2 sing Y N 370 TRP CE3 CZ3 doub Y N 371 TRP CE3 HE3 sing N N 372 TRP CZ2 CH2 doub Y N 373 TRP CZ2 HZ2 sing N N 374 TRP CZ3 CH2 sing Y N 375 TRP CZ3 HZ3 sing N N 376 TRP CH2 HH2 sing N N 377 TRP OXT HXT sing N N 378 TYR N CA sing N N 379 TYR N H sing N N 380 TYR N H2 sing N N 381 TYR CA C sing N N 382 TYR CA CB sing N N 383 TYR CA HA sing N N 384 TYR C O doub N N 385 TYR C OXT sing N N 386 TYR CB CG sing N N 387 TYR CB HB2 sing N N 388 TYR CB HB3 sing N N 389 TYR CG CD1 doub Y N 390 TYR CG CD2 sing Y N 391 TYR CD1 CE1 sing Y N 392 TYR CD1 HD1 sing N N 393 TYR CD2 CE2 doub Y N 394 TYR CD2 HD2 sing N N 395 TYR CE1 CZ doub Y N 396 TYR CE1 HE1 sing N N 397 TYR CE2 CZ sing Y N 398 TYR CE2 HE2 sing N N 399 TYR CZ OH sing N N 400 TYR OH HH sing N N 401 TYR OXT HXT sing N N 402 VAL N CA sing N N 403 VAL N H sing N N 404 VAL N H2 sing N N 405 VAL CA C sing N N 406 VAL CA CB sing N N 407 VAL CA HA sing N N 408 VAL C O doub N N 409 VAL C OXT sing N N 410 VAL CB CG1 sing N N 411 VAL CB CG2 sing N N 412 VAL CB HB sing N N 413 VAL CG1 HG11 sing N N 414 VAL CG1 HG12 sing N N 415 VAL CG1 HG13 sing N N 416 VAL CG2 HG21 sing N N 417 VAL CG2 HG22 sing N N 418 VAL CG2 HG23 sing N N 419 VAL OXT HXT sing N N 420 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'UNKNOWN ATOM OR ION' UNX 4 "GUANOSINE-5'-DIPHOSPHATE" GDP 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3RAB _pdbx_initial_refinement_model.details 'pdb entry 3RAB' #