data_2GG7 # _entry.id 2GG7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.377 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2GG7 pdb_00002gg7 10.2210/pdb2gg7/pdb RCSB RCSB037077 ? ? WWPDB D_1000037077 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2GG0 'Novel bacterial methionine aminopeptidase inhibitors' unspecified PDB 2GG2 'Novel bacterial methionine aminopeptidase inhibitors' unspecified PDB 2GG3 'Novel bacterial methionine aminopeptidase inhibitors' unspecified PDB 2GG5 'Novel bacterial methionine aminopeptidase inhibitors' unspecified PDB 2GG8 'Novel bacterial methionine aminopeptidase inhibitors' unspecified PDB 2GG9 'Novel bacterial methionine aminopeptidase inhibitors' unspecified PDB 2GGB 'Novel bacterial methionine aminopeptidase inhibitors' unspecified PDB 2GGC 'Novel bacterial methionine aminopeptidase inhibitors' unspecified # _pdbx_database_status.entry_id 2GG7 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2006-03-23 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Evdokimov, A.G.' 1 'Pokross, M.E.' 2 'Walter, R.L.' 3 'Mekel, M.' 4 # _citation.id primary _citation.title 'Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.' _citation.journal_abbrev Proteins _citation.journal_volume 66 _citation.page_first 538 _citation.page_last 546 _citation.year 2007 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17120228 _citation.pdbx_database_id_DOI 10.1002/prot.21207 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Evdokimov, A.G.' 1 ? primary 'Pokross, M.' 2 ? primary 'Walter, R.L.' 3 ? primary 'Mekel, M.' 4 ? primary 'Barnett, B.L.' 5 ? primary 'Amburgey, J.' 6 ? primary 'Seibel, W.L.' 7 ? primary 'Soper, S.J.' 8 ? primary 'Djung, J.F.' 9 ? primary 'Fairweather, N.' 10 ? primary 'Diven, C.' 11 ? primary 'Rastogi, V.' 12 ? primary 'Grinius, L.' 13 ? primary 'Klanke, C.' 14 ? primary 'Siehnel, R.' 15 ? primary 'Twinem, T.' 16 ? primary 'Andrews, R.' 17 ? primary 'Curnow, A.' 18 ? # _cell.entry_id 2GG7 _cell.length_a 39.123 _cell.length_b 62.945 _cell.length_c 52.743 _cell.angle_alpha 90.00 _cell.angle_beta 109.01 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2GG7 _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Methionine aminopeptidase' 29239.643 1 3.4.11.18 ? ? ? 2 non-polymer syn 'COBALT (II) ION' 58.933 2 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 non-polymer syn '3-(5-AMINO-3-IMINO-3H-PYRAZOL-4-YLAZO)-BENZOIC ACID' 244.210 1 ? ? ? ? 5 water nat water 18.015 504 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MAP, Peptidase M' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGI PDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEG FSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVT DNGCEILTLRKDDTIPAIISHDE ; _entity_poly.pdbx_seq_one_letter_code_can ;AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGI PDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEG FSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVT DNGCEILTLRKDDTIPAIISHDE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ILE n 1 3 SER n 1 4 ILE n 1 5 LYS n 1 6 THR n 1 7 PRO n 1 8 GLU n 1 9 ASP n 1 10 ILE n 1 11 GLU n 1 12 LYS n 1 13 MET n 1 14 ARG n 1 15 VAL n 1 16 ALA n 1 17 GLY n 1 18 ARG n 1 19 LEU n 1 20 ALA n 1 21 ALA n 1 22 GLU n 1 23 VAL n 1 24 LEU n 1 25 GLU n 1 26 MET n 1 27 ILE n 1 28 GLU n 1 29 PRO n 1 30 TYR n 1 31 VAL n 1 32 LYS n 1 33 PRO n 1 34 GLY n 1 35 VAL n 1 36 SER n 1 37 THR n 1 38 GLY n 1 39 GLU n 1 40 LEU n 1 41 ASP n 1 42 ARG n 1 43 ILE n 1 44 CYS n 1 45 ASN n 1 46 ASP n 1 47 TYR n 1 48 ILE n 1 49 VAL n 1 50 ASN n 1 51 GLU n 1 52 GLN n 1 53 HIS n 1 54 ALA n 1 55 VAL n 1 56 SER n 1 57 ALA n 1 58 CYS n 1 59 LEU n 1 60 GLY n 1 61 TYR n 1 62 HIS n 1 63 GLY n 1 64 TYR n 1 65 PRO n 1 66 LYS n 1 67 SER n 1 68 VAL n 1 69 CYS n 1 70 ILE n 1 71 SER n 1 72 ILE n 1 73 ASN n 1 74 GLU n 1 75 VAL n 1 76 VAL n 1 77 CYS n 1 78 HIS n 1 79 GLY n 1 80 ILE n 1 81 PRO n 1 82 ASP n 1 83 ASP n 1 84 ALA n 1 85 LYS n 1 86 LEU n 1 87 LEU n 1 88 LYS n 1 89 ASP n 1 90 GLY n 1 91 ASP n 1 92 ILE n 1 93 VAL n 1 94 ASN n 1 95 ILE n 1 96 ASP n 1 97 VAL n 1 98 THR n 1 99 VAL n 1 100 ILE n 1 101 LYS n 1 102 ASP n 1 103 GLY n 1 104 PHE n 1 105 HIS n 1 106 GLY n 1 107 ASP n 1 108 THR n 1 109 SER n 1 110 LYS n 1 111 MET n 1 112 PHE n 1 113 ILE n 1 114 VAL n 1 115 GLY n 1 116 LYS n 1 117 PRO n 1 118 THR n 1 119 ILE n 1 120 MET n 1 121 GLY n 1 122 GLU n 1 123 ARG n 1 124 LEU n 1 125 CYS n 1 126 ARG n 1 127 ILE n 1 128 THR n 1 129 GLN n 1 130 GLU n 1 131 SER n 1 132 LEU n 1 133 TYR n 1 134 LEU n 1 135 ALA n 1 136 LEU n 1 137 ARG n 1 138 MET n 1 139 VAL n 1 140 LYS n 1 141 PRO n 1 142 GLY n 1 143 ILE n 1 144 ASN n 1 145 LEU n 1 146 ARG n 1 147 GLU n 1 148 ILE n 1 149 GLY n 1 150 ALA n 1 151 ALA n 1 152 ILE n 1 153 GLN n 1 154 LYS n 1 155 PHE n 1 156 VAL n 1 157 GLU n 1 158 ALA n 1 159 GLU n 1 160 GLY n 1 161 PHE n 1 162 SER n 1 163 VAL n 1 164 VAL n 1 165 ARG n 1 166 GLU n 1 167 TYR n 1 168 CYS n 1 169 GLY n 1 170 HIS n 1 171 GLY n 1 172 ILE n 1 173 GLY n 1 174 ARG n 1 175 GLY n 1 176 PHE n 1 177 HIS n 1 178 GLU n 1 179 GLU n 1 180 PRO n 1 181 GLN n 1 182 VAL n 1 183 LEU n 1 184 HIS n 1 185 TYR n 1 186 ASP n 1 187 SER n 1 188 ARG n 1 189 GLU n 1 190 THR n 1 191 ASN n 1 192 VAL n 1 193 VAL n 1 194 LEU n 1 195 LYS n 1 196 PRO n 1 197 GLY n 1 198 MET n 1 199 THR n 1 200 PHE n 1 201 THR n 1 202 ILE n 1 203 GLU n 1 204 PRO n 1 205 MET n 1 206 VAL n 1 207 ASN n 1 208 ALA n 1 209 GLY n 1 210 LYS n 1 211 LYS n 1 212 GLU n 1 213 ILE n 1 214 ARG n 1 215 THR n 1 216 MET n 1 217 LYS n 1 218 ASP n 1 219 GLY n 1 220 TRP n 1 221 THR n 1 222 VAL n 1 223 LYS n 1 224 THR n 1 225 LYS n 1 226 ASP n 1 227 ARG n 1 228 SER n 1 229 LEU n 1 230 SER n 1 231 ALA n 1 232 GLN n 1 233 TYR n 1 234 GLU n 1 235 HIS n 1 236 THR n 1 237 ILE n 1 238 VAL n 1 239 VAL n 1 240 THR n 1 241 ASP n 1 242 ASN n 1 243 GLY n 1 244 CYS n 1 245 GLU n 1 246 ILE n 1 247 LEU n 1 248 THR n 1 249 LEU n 1 250 ARG n 1 251 LYS n 1 252 ASP n 1 253 ASP n 1 254 THR n 1 255 ILE n 1 256 PRO n 1 257 ALA n 1 258 ILE n 1 259 ILE n 1 260 SER n 1 261 HIS n 1 262 ASP n 1 263 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene map _entity_src_gen.gene_src_species 'Escherichia coli' _entity_src_gen.gene_src_strain K-12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli K12' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AMPM_ECOLI _struct_ref.pdbx_db_accession P0AE18 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGI PDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEG FSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVT DNGCEILTLRKDDTIPAIISHDE ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2GG7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 263 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0AE18 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 264 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 264 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CO non-polymer . 'COBALT (II) ION' ? 'Co 2' 58.933 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U14 non-polymer . '3-(5-AMINO-3-IMINO-3H-PYRAZOL-4-YLAZO)-BENZOIC ACID' ? 'C10 H8 N6 O2' 244.210 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 2GG7 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.10 _exptl_crystal.density_percent_sol 41.40 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method batch _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.temp 298 _exptl_crystal_grow.pdbx_details '10 mg/ml protein, 25% PEG 8000, 100 mM TRIS-HCl, 1-5 mM inhibitor, pH 7.0, batch, temperature 298K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2002-01-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator Si _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 17-ID # _reflns.entry_id 2GG7 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 1.12 _reflns.d_resolution_low 23.98 _reflns.number_all 91914 _reflns.number_obs 91914 _reflns.percent_possible_obs 93.2 _reflns.pdbx_Rmerge_I_obs 0.021 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 28.1 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.12 _reflns_shell.d_res_low 1.25 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 73.2 _reflns_shell.Rmerge_I_obs 0.082 _reflns_shell.meanI_over_sigI_obs 11.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 1.5 _reflns_shell.number_unique_all 25659 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2GG7 _refine.ls_d_res_high 1.120 _refine.ls_d_res_low 23.98 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 99.140 _refine.ls_number_reflns_obs 91867 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.ls_R_factor_all 0.133 _refine.ls_R_factor_R_work 0.132 _refine.ls_R_factor_R_free 0.155 _refine.ls_percent_reflns_R_free 5.000 _refine.ls_number_reflns_R_free 4597 _refine.B_iso_mean 11.436 _refine.aniso_B[1][1] -0.220 _refine.aniso_B[2][2] 0.380 _refine.aniso_B[3][3] -0.010 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.240 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.976 _refine.correlation_coeff_Fo_to_Fc_free 0.967 _refine.pdbx_overall_ESU_R 0.032 _refine.pdbx_overall_ESU_R_Free 0.032 _refine.overall_SU_ML 0.018 _refine.overall_SU_B 0.788 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_ls_sigma_I 0 _refine.ls_number_reflns_all 91867 _refine.ls_R_factor_obs 0.132 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB ENTRY 2GG2' _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2224 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.number_atoms_solvent 504 _refine_hist.number_atoms_total 2749 _refine_hist.d_res_high 1.120 _refine_hist.d_res_low 23.98 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 2308 0.007 0.022 ? 'X-RAY DIFFRACTION' ? r_bond_other_d 2141 0.000 0.020 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 3160 1.640 1.986 ? 'X-RAY DIFFRACTION' ? r_angle_other_deg 5033 0.727 3.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 320 6.013 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 105 35.559 24.381 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 445 11.581 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 17 18.141 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 355 0.085 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 2631 0.005 0.020 ? 'X-RAY DIFFRACTION' ? r_gen_planes_other 453 0.001 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 442 0.229 0.200 ? 'X-RAY DIFFRACTION' ? r_nbd_other 2303 0.193 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 1138 0.176 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_other 1248 0.086 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 356 0.164 0.200 ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined 4 0.164 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 14 0.174 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 64 0.372 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 69 0.186 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1406 1.585 1.500 ? 'X-RAY DIFFRACTION' ? r_mcbond_other 573 1.053 1.500 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2324 2.270 2.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 917 3.001 3.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 812 4.354 4.500 ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 4530 1.483 3.000 ? 'X-RAY DIFFRACTION' ? r_sphericity_free 511 9.599 3.000 ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded 4383 5.375 3.000 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 1.120 _refine_ls_shell.d_res_low 1.149 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 97.630 _refine_ls_shell.number_reflns_R_work 6333 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.177 _refine_ls_shell.R_factor_R_free 0.195 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 330 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 6663 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2GG7 _struct.title 'Novel bacterial methionine aminopeptidase inhibitors' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2GG7 _struct_keywords.text 'methionine amino peptidase, pita-bread fold, MAP inhibitor, antibacterial, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 6 ? GLU A 28 ? THR A 7 GLU A 29 1 ? 23 HELX_P HELX_P2 2 PRO A 29 ? VAL A 31 ? PRO A 30 VAL A 32 5 ? 3 HELX_P HELX_P3 3 SER A 36 ? GLU A 51 ? SER A 37 GLU A 52 1 ? 16 HELX_P HELX_P4 4 GLY A 60 ? TYR A 64 ? GLY A 61 TYR A 65 5 ? 5 HELX_P HELX_P5 5 THR A 118 ? VAL A 139 ? THR A 119 VAL A 140 1 ? 22 HELX_P HELX_P6 6 ASN A 144 ? GLU A 159 ? ASN A 145 GLU A 160 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASN 73 O ? ? ? 1_555 D NA . NA ? ? A ASN 74 A NA 703 1_555 ? ? ? ? ? ? ? 2.255 ? ? metalc2 metalc ? ? A VAL 75 O ? ? ? 1_555 D NA . NA ? ? A VAL 76 A NA 703 1_555 ? ? ? ? ? ? ? 2.251 ? ? metalc3 metalc ? ? A ASP 96 OD1 ? ? ? 1_555 C CO . CO ? ? A ASP 97 A CO 302 1_555 ? ? ? ? ? ? ? 2.027 ? ? metalc4 metalc ? ? A ASP 96 OD2 ? ? ? 1_555 C CO . CO ? ? A ASP 97 A CO 302 1_555 ? ? ? ? ? ? ? 2.443 ? ? metalc5 metalc ? ? A ASP 107 OD2 ? ? ? 1_555 B CO . CO ? ? A ASP 108 A CO 301 1_555 ? ? ? ? ? ? ? 2.146 ? ? metalc6 metalc ? ? A ASP 107 OD1 ? ? ? 1_555 C CO . CO ? ? A ASP 108 A CO 302 1_555 ? ? ? ? ? ? ? 1.986 ? ? metalc7 metalc ? ? A HIS 170 NE2 ? ? ? 1_555 B CO . CO ? ? A HIS 171 A CO 301 1_555 ? ? ? ? ? ? ? 2.087 ? ? metalc8 metalc ? ? A GLU 203 OE2 A ? ? 1_555 B CO . CO ? ? A GLU 204 A CO 301 1_555 ? ? ? ? ? ? ? 2.063 ? ? metalc9 metalc ? ? A GLU 203 OE2 B ? ? 1_555 B CO . CO ? ? A GLU 204 A CO 301 1_555 ? ? ? ? ? ? ? 2.217 ? ? metalc10 metalc ? ? A SER 230 O ? ? ? 1_555 D NA . NA ? ? A SER 231 A NA 703 1_555 ? ? ? ? ? ? ? 2.256 ? ? metalc11 metalc ? ? A GLU 234 OE2 A ? ? 1_555 B CO . CO ? ? A GLU 235 A CO 301 1_555 ? ? ? ? ? ? ? 2.003 ? ? metalc12 metalc ? ? A GLU 234 OE2 B ? ? 1_555 B CO . CO ? ? A GLU 235 A CO 301 1_555 ? ? ? ? ? ? ? 2.236 ? ? metalc13 metalc ? ? A GLU 234 OE1 A ? ? 1_555 C CO . CO ? ? A GLU 235 A CO 302 1_555 ? ? ? ? ? ? ? 2.046 ? ? metalc14 metalc ? ? A GLU 234 OE1 B ? ? 1_555 C CO . CO ? ? A GLU 235 A CO 302 1_555 ? ? ? ? ? ? ? 2.028 ? ? metalc15 metalc ? ? A GLU 234 OE2 B ? ? 1_555 C CO . CO ? ? A GLU 235 A CO 302 1_555 ? ? ? ? ? ? ? 2.206 ? ? metalc16 metalc ? ? B CO . CO ? ? ? 1_555 E U14 . N2 ? ? A CO 301 A U14 701 1_555 ? ? ? ? ? ? ? 2.018 ? ? metalc17 metalc ? ? C CO . CO ? ? ? 1_555 E U14 . N3 ? ? A CO 302 A U14 701 1_555 ? ? ? ? ? ? ? 1.984 ? ? metalc18 metalc ? ? D NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 703 A HOH 793 1_555 ? ? ? ? ? ? ? 2.225 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 179 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 180 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 180 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 181 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.35 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? C ? 3 ? D ? 3 ? E ? 2 ? F ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel E 1 2 ? anti-parallel F 1 2 ? anti-parallel F 2 3 ? anti-parallel F 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 55 ? SER A 56 ? VAL A 56 SER A 57 A 2 ILE A 92 ? LYS A 101 ? ILE A 93 LYS A 102 A 3 CYS A 69 ? ILE A 72 ? CYS A 70 ILE A 73 B 1 VAL A 55 ? SER A 56 ? VAL A 56 SER A 57 B 2 ILE A 92 ? LYS A 101 ? ILE A 93 LYS A 102 B 3 PHE A 104 ? ILE A 113 ? PHE A 105 ILE A 114 C 1 VAL A 75 ? CYS A 77 ? VAL A 76 CYS A 78 C 2 VAL A 222 ? THR A 224 ? VAL A 223 THR A 225 C 3 ILE A 213 ? THR A 215 ? ILE A 214 THR A 216 D 1 SER A 162 ? VAL A 163 ? SER A 163 VAL A 164 D 2 MET A 205 ? ASN A 207 ? MET A 206 ASN A 208 D 3 SER A 230 ? GLN A 232 ? SER A 231 GLN A 233 E 1 GLY A 169 ? GLY A 171 ? GLY A 170 GLY A 172 E 2 GLU A 178 ? VAL A 182 ? GLU A 179 VAL A 183 F 1 THR A 199 ? ILE A 202 ? THR A 200 ILE A 203 F 2 HIS A 235 ? VAL A 239 ? HIS A 236 VAL A 240 F 3 GLY A 243 ? ILE A 246 ? GLY A 244 ILE A 247 F 4 ILE A 258 ? SER A 260 ? ILE A 259 SER A 261 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 55 ? N VAL A 56 O ILE A 100 ? O ILE A 101 A 2 3 O ASN A 94 ? O ASN A 95 N SER A 71 ? N SER A 72 B 1 2 N VAL A 55 ? N VAL A 56 O ILE A 100 ? O ILE A 101 B 2 3 N VAL A 97 ? N VAL A 98 O THR A 108 ? O THR A 109 C 1 2 N VAL A 76 ? N VAL A 77 O VAL A 222 ? O VAL A 223 C 2 3 O LYS A 223 ? O LYS A 224 N ARG A 214 ? N ARG A 215 D 1 2 N SER A 162 ? N SER A 163 O ASN A 207 ? O ASN A 208 D 2 3 N VAL A 206 ? N VAL A 207 O ALA A 231 ? O ALA A 232 E 1 2 N GLY A 169 ? N GLY A 170 O VAL A 182 ? O VAL A 183 F 1 2 N PHE A 200 ? N PHE A 201 O ILE A 237 ? O ILE A 238 F 2 3 N VAL A 238 ? N VAL A 239 O GLU A 245 ? O GLU A 246 F 3 4 N CYS A 244 ? N CYS A 245 O ILE A 259 ? O ILE A 260 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CO 301 ? 6 'BINDING SITE FOR RESIDUE CO A 301' AC2 Software A CO 302 ? 6 'BINDING SITE FOR RESIDUE CO A 302' AC3 Software A NA 703 ? 4 'BINDING SITE FOR RESIDUE NA A 703' AC4 Software A U14 701 ? 20 'BINDING SITE FOR RESIDUE U14 A 701' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 107 ? ASP A 108 . ? 1_555 ? 2 AC1 6 HIS A 170 ? HIS A 171 . ? 1_555 ? 3 AC1 6 GLU A 203 ? GLU A 204 . ? 1_555 ? 4 AC1 6 GLU A 234 ? GLU A 235 . ? 1_555 ? 5 AC1 6 CO C . ? CO A 302 . ? 1_555 ? 6 AC1 6 U14 E . ? U14 A 701 . ? 1_555 ? 7 AC2 6 ASP A 96 ? ASP A 97 . ? 1_555 ? 8 AC2 6 THR A 98 ? THR A 99 . ? 1_555 ? 9 AC2 6 ASP A 107 ? ASP A 108 . ? 1_555 ? 10 AC2 6 GLU A 234 ? GLU A 235 . ? 1_555 ? 11 AC2 6 CO B . ? CO A 301 . ? 1_555 ? 12 AC2 6 U14 E . ? U14 A 701 . ? 1_555 ? 13 AC3 4 ASN A 73 ? ASN A 74 . ? 1_555 ? 14 AC3 4 VAL A 75 ? VAL A 76 . ? 1_555 ? 15 AC3 4 SER A 230 ? SER A 231 . ? 1_555 ? 16 AC3 4 HOH F . ? HOH A 793 . ? 1_555 ? 17 AC4 20 CYS A 58 ? CYS A 59 . ? 1_555 ? 18 AC4 20 TYR A 61 ? TYR A 62 . ? 1_555 ? 19 AC4 20 HIS A 62 ? HIS A 63 . ? 1_555 ? 20 AC4 20 TYR A 64 ? TYR A 65 . ? 1_555 ? 21 AC4 20 HIS A 78 ? HIS A 79 . ? 1_555 ? 22 AC4 20 ASP A 96 ? ASP A 97 . ? 1_555 ? 23 AC4 20 ASP A 107 ? ASP A 108 . ? 1_555 ? 24 AC4 20 HIS A 170 ? HIS A 171 . ? 1_555 ? 25 AC4 20 PHE A 176 ? PHE A 177 . ? 1_555 ? 26 AC4 20 HIS A 177 ? HIS A 178 . ? 1_555 ? 27 AC4 20 GLU A 203 ? GLU A 204 . ? 1_555 ? 28 AC4 20 TRP A 220 ? TRP A 221 . ? 1_555 ? 29 AC4 20 GLU A 234 ? GLU A 235 . ? 1_555 ? 30 AC4 20 CO B . ? CO A 301 . ? 1_555 ? 31 AC4 20 CO C . ? CO A 302 . ? 1_555 ? 32 AC4 20 HOH F . ? HOH A 1017 . ? 1_555 ? 33 AC4 20 HOH F . ? HOH A 1047 . ? 1_555 ? 34 AC4 20 HOH F . ? HOH A 1157 . ? 1_555 ? 35 AC4 20 HOH F . ? HOH A 1183 . ? 1_455 ? 36 AC4 20 HOH F . ? HOH A 1191 . ? 1_555 ? # _atom_sites.entry_id 2GG7 _atom_sites.fract_transf_matrix[1][1] 0.025560 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.008806 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015887 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020054 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CO N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 2 2 ALA ALA A . n A 1 2 ILE 2 3 3 ILE ILE A . n A 1 3 SER 3 4 4 SER SER A . n A 1 4 ILE 4 5 5 ILE ILE A . n A 1 5 LYS 5 6 6 LYS LYS A . n A 1 6 THR 6 7 7 THR THR A . n A 1 7 PRO 7 8 8 PRO PRO A . n A 1 8 GLU 8 9 9 GLU GLU A . n A 1 9 ASP 9 10 10 ASP ASP A . n A 1 10 ILE 10 11 11 ILE ILE A . n A 1 11 GLU 11 12 12 GLU GLU A . n A 1 12 LYS 12 13 13 LYS LYS A . n A 1 13 MET 13 14 14 MET MET A . n A 1 14 ARG 14 15 15 ARG ARG A . n A 1 15 VAL 15 16 16 VAL VAL A . n A 1 16 ALA 16 17 17 ALA ALA A . n A 1 17 GLY 17 18 18 GLY GLY A . n A 1 18 ARG 18 19 19 ARG ARG A . n A 1 19 LEU 19 20 20 LEU LEU A . n A 1 20 ALA 20 21 21 ALA ALA A . n A 1 21 ALA 21 22 22 ALA ALA A . n A 1 22 GLU 22 23 23 GLU GLU A . n A 1 23 VAL 23 24 24 VAL VAL A . n A 1 24 LEU 24 25 25 LEU LEU A . n A 1 25 GLU 25 26 26 GLU GLU A . n A 1 26 MET 26 27 27 MET MET A . n A 1 27 ILE 27 28 28 ILE ILE A . n A 1 28 GLU 28 29 29 GLU GLU A . n A 1 29 PRO 29 30 30 PRO PRO A . n A 1 30 TYR 30 31 31 TYR TYR A . n A 1 31 VAL 31 32 32 VAL VAL A . n A 1 32 LYS 32 33 33 LYS LYS A . n A 1 33 PRO 33 34 34 PRO PRO A . n A 1 34 GLY 34 35 35 GLY GLY A . n A 1 35 VAL 35 36 36 VAL VAL A . n A 1 36 SER 36 37 37 SER SER A . n A 1 37 THR 37 38 38 THR THR A . n A 1 38 GLY 38 39 39 GLY GLY A . n A 1 39 GLU 39 40 40 GLU GLU A . n A 1 40 LEU 40 41 41 LEU LEU A . n A 1 41 ASP 41 42 42 ASP ASP A . n A 1 42 ARG 42 43 43 ARG ARG A . n A 1 43 ILE 43 44 44 ILE ILE A . n A 1 44 CYS 44 45 45 CYS CYS A . n A 1 45 ASN 45 46 46 ASN ASN A . n A 1 46 ASP 46 47 47 ASP ASP A . n A 1 47 TYR 47 48 48 TYR TYR A . n A 1 48 ILE 48 49 49 ILE ILE A . n A 1 49 VAL 49 50 50 VAL VAL A . n A 1 50 ASN 50 51 51 ASN ASN A . n A 1 51 GLU 51 52 52 GLU GLU A . n A 1 52 GLN 52 53 53 GLN GLN A . n A 1 53 HIS 53 54 54 HIS HIS A . n A 1 54 ALA 54 55 55 ALA ALA A . n A 1 55 VAL 55 56 56 VAL VAL A . n A 1 56 SER 56 57 57 SER SER A . n A 1 57 ALA 57 58 58 ALA ALA A . n A 1 58 CYS 58 59 59 CYS CYS A . n A 1 59 LEU 59 60 60 LEU LEU A . n A 1 60 GLY 60 61 61 GLY GLY A . n A 1 61 TYR 61 62 62 TYR TYR A . n A 1 62 HIS 62 63 63 HIS HIS A . n A 1 63 GLY 63 64 64 GLY GLY A . n A 1 64 TYR 64 65 65 TYR TYR A . n A 1 65 PRO 65 66 66 PRO PRO A . n A 1 66 LYS 66 67 67 LYS LYS A . n A 1 67 SER 67 68 68 SER SER A . n A 1 68 VAL 68 69 69 VAL VAL A . n A 1 69 CYS 69 70 70 CYS CYS A . n A 1 70 ILE 70 71 71 ILE ILE A . n A 1 71 SER 71 72 72 SER SER A . n A 1 72 ILE 72 73 73 ILE ILE A . n A 1 73 ASN 73 74 74 ASN ASN A . n A 1 74 GLU 74 75 75 GLU GLU A . n A 1 75 VAL 75 76 76 VAL VAL A . n A 1 76 VAL 76 77 77 VAL VAL A . n A 1 77 CYS 77 78 78 CYS CYS A . n A 1 78 HIS 78 79 79 HIS HIS A . n A 1 79 GLY 79 80 80 GLY GLY A . n A 1 80 ILE 80 81 81 ILE ILE A . n A 1 81 PRO 81 82 82 PRO PRO A . n A 1 82 ASP 82 83 83 ASP ASP A . n A 1 83 ASP 83 84 84 ASP ASP A . n A 1 84 ALA 84 85 85 ALA ALA A . n A 1 85 LYS 85 86 86 LYS LYS A . n A 1 86 LEU 86 87 87 LEU LEU A . n A 1 87 LEU 87 88 88 LEU LEU A . n A 1 88 LYS 88 89 89 LYS LYS A . n A 1 89 ASP 89 90 90 ASP ASP A . n A 1 90 GLY 90 91 91 GLY GLY A . n A 1 91 ASP 91 92 92 ASP ASP A . n A 1 92 ILE 92 93 93 ILE ILE A . n A 1 93 VAL 93 94 94 VAL VAL A . n A 1 94 ASN 94 95 95 ASN ASN A . n A 1 95 ILE 95 96 96 ILE ILE A . n A 1 96 ASP 96 97 97 ASP ASP A . n A 1 97 VAL 97 98 98 VAL VAL A . n A 1 98 THR 98 99 99 THR THR A . n A 1 99 VAL 99 100 100 VAL VAL A . n A 1 100 ILE 100 101 101 ILE ILE A . n A 1 101 LYS 101 102 102 LYS LYS A . n A 1 102 ASP 102 103 103 ASP ASP A . n A 1 103 GLY 103 104 104 GLY GLY A . n A 1 104 PHE 104 105 105 PHE PHE A . n A 1 105 HIS 105 106 106 HIS HIS A . n A 1 106 GLY 106 107 107 GLY GLY A . n A 1 107 ASP 107 108 108 ASP ASP A . n A 1 108 THR 108 109 109 THR THR A . n A 1 109 SER 109 110 110 SER SER A . n A 1 110 LYS 110 111 111 LYS LYS A . n A 1 111 MET 111 112 112 MET MET A . n A 1 112 PHE 112 113 113 PHE PHE A . n A 1 113 ILE 113 114 114 ILE ILE A . n A 1 114 VAL 114 115 115 VAL VAL A . n A 1 115 GLY 115 116 116 GLY GLY A . n A 1 116 LYS 116 117 117 LYS LYS A . n A 1 117 PRO 117 118 118 PRO PRO A . n A 1 118 THR 118 119 119 THR THR A . n A 1 119 ILE 119 120 120 ILE ILE A . n A 1 120 MET 120 121 121 MET MET A . n A 1 121 GLY 121 122 122 GLY GLY A . n A 1 122 GLU 122 123 123 GLU GLU A . n A 1 123 ARG 123 124 124 ARG ARG A . n A 1 124 LEU 124 125 125 LEU LEU A . n A 1 125 CYS 125 126 126 CYS CYS A . n A 1 126 ARG 126 127 127 ARG ARG A . n A 1 127 ILE 127 128 128 ILE ILE A . n A 1 128 THR 128 129 129 THR THR A . n A 1 129 GLN 129 130 130 GLN GLN A . n A 1 130 GLU 130 131 131 GLU GLU A . n A 1 131 SER 131 132 132 SER SER A . n A 1 132 LEU 132 133 133 LEU LEU A . n A 1 133 TYR 133 134 134 TYR TYR A . n A 1 134 LEU 134 135 135 LEU LEU A . n A 1 135 ALA 135 136 136 ALA ALA A . n A 1 136 LEU 136 137 137 LEU LEU A . n A 1 137 ARG 137 138 138 ARG ARG A . n A 1 138 MET 138 139 139 MET MET A . n A 1 139 VAL 139 140 140 VAL VAL A . n A 1 140 LYS 140 141 141 LYS LYS A . n A 1 141 PRO 141 142 142 PRO PRO A . n A 1 142 GLY 142 143 143 GLY GLY A . n A 1 143 ILE 143 144 144 ILE ILE A . n A 1 144 ASN 144 145 145 ASN ASN A . n A 1 145 LEU 145 146 146 LEU LEU A . n A 1 146 ARG 146 147 147 ARG ARG A . n A 1 147 GLU 147 148 148 GLU GLU A . n A 1 148 ILE 148 149 149 ILE ILE A . n A 1 149 GLY 149 150 150 GLY GLY A . n A 1 150 ALA 150 151 151 ALA ALA A . n A 1 151 ALA 151 152 152 ALA ALA A . n A 1 152 ILE 152 153 153 ILE ILE A . n A 1 153 GLN 153 154 154 GLN GLN A . n A 1 154 LYS 154 155 155 LYS LYS A . n A 1 155 PHE 155 156 156 PHE PHE A . n A 1 156 VAL 156 157 157 VAL VAL A . n A 1 157 GLU 157 158 158 GLU GLU A . n A 1 158 ALA 158 159 159 ALA ALA A . n A 1 159 GLU 159 160 160 GLU GLU A . n A 1 160 GLY 160 161 161 GLY GLY A . n A 1 161 PHE 161 162 162 PHE PHE A . n A 1 162 SER 162 163 163 SER SER A . n A 1 163 VAL 163 164 164 VAL VAL A . n A 1 164 VAL 164 165 165 VAL VAL A . n A 1 165 ARG 165 166 166 ARG ARG A . n A 1 166 GLU 166 167 167 GLU GLU A . n A 1 167 TYR 167 168 168 TYR TYR A . n A 1 168 CYS 168 169 169 CYS CYS A . n A 1 169 GLY 169 170 170 GLY GLY A . n A 1 170 HIS 170 171 171 HIS HIS A . n A 1 171 GLY 171 172 172 GLY GLY A . n A 1 172 ILE 172 173 173 ILE ILE A . n A 1 173 GLY 173 174 174 GLY GLY A . n A 1 174 ARG 174 175 175 ARG ARG A . n A 1 175 GLY 175 176 176 GLY GLY A . n A 1 176 PHE 176 177 177 PHE PHE A . n A 1 177 HIS 177 178 178 HIS HIS A . n A 1 178 GLU 178 179 179 GLU GLU A . n A 1 179 GLU 179 180 180 GLU GLU A . n A 1 180 PRO 180 181 181 PRO PRO A . n A 1 181 GLN 181 182 182 GLN GLN A . n A 1 182 VAL 182 183 183 VAL VAL A . n A 1 183 LEU 183 184 184 LEU LEU A . n A 1 184 HIS 184 185 185 HIS HIS A . n A 1 185 TYR 185 186 186 TYR TYR A . n A 1 186 ASP 186 187 187 ASP ASP A . n A 1 187 SER 187 188 188 SER SER A . n A 1 188 ARG 188 189 189 ARG ARG A . n A 1 189 GLU 189 190 190 GLU GLU A . n A 1 190 THR 190 191 191 THR THR A . n A 1 191 ASN 191 192 192 ASN ASN A . n A 1 192 VAL 192 193 193 VAL VAL A . n A 1 193 VAL 193 194 194 VAL VAL A . n A 1 194 LEU 194 195 195 LEU LEU A . n A 1 195 LYS 195 196 196 LYS LYS A . n A 1 196 PRO 196 197 197 PRO PRO A . n A 1 197 GLY 197 198 198 GLY GLY A . n A 1 198 MET 198 199 199 MET MET A . n A 1 199 THR 199 200 200 THR THR A . n A 1 200 PHE 200 201 201 PHE PHE A . n A 1 201 THR 201 202 202 THR THR A . n A 1 202 ILE 202 203 203 ILE ILE A . n A 1 203 GLU 203 204 204 GLU GLU A . n A 1 204 PRO 204 205 205 PRO PRO A . n A 1 205 MET 205 206 206 MET MET A . n A 1 206 VAL 206 207 207 VAL VAL A . n A 1 207 ASN 207 208 208 ASN ASN A . n A 1 208 ALA 208 209 209 ALA ALA A . n A 1 209 GLY 209 210 210 GLY GLY A . n A 1 210 LYS 210 211 211 LYS LYS A . n A 1 211 LYS 211 212 212 LYS LYS A . n A 1 212 GLU 212 213 213 GLU GLU A . n A 1 213 ILE 213 214 214 ILE ILE A . n A 1 214 ARG 214 215 215 ARG ARG A . n A 1 215 THR 215 216 216 THR THR A . n A 1 216 MET 216 217 217 MET MET A . n A 1 217 LYS 217 218 218 LYS LYS A . n A 1 218 ASP 218 219 219 ASP ASP A . n A 1 219 GLY 219 220 220 GLY GLY A . n A 1 220 TRP 220 221 221 TRP TRP A . n A 1 221 THR 221 222 222 THR THR A . n A 1 222 VAL 222 223 223 VAL VAL A . n A 1 223 LYS 223 224 224 LYS LYS A . n A 1 224 THR 224 225 225 THR THR A . n A 1 225 LYS 225 226 226 LYS LYS A . n A 1 226 ASP 226 227 227 ASP ASP A . n A 1 227 ARG 227 228 228 ARG ARG A . n A 1 228 SER 228 229 229 SER SER A . n A 1 229 LEU 229 230 230 LEU LEU A . n A 1 230 SER 230 231 231 SER SER A . n A 1 231 ALA 231 232 232 ALA ALA A . n A 1 232 GLN 232 233 233 GLN GLN A . n A 1 233 TYR 233 234 234 TYR TYR A . n A 1 234 GLU 234 235 235 GLU GLU A . n A 1 235 HIS 235 236 236 HIS HIS A . n A 1 236 THR 236 237 237 THR THR A . n A 1 237 ILE 237 238 238 ILE ILE A . n A 1 238 VAL 238 239 239 VAL VAL A . n A 1 239 VAL 239 240 240 VAL VAL A . n A 1 240 THR 240 241 241 THR THR A . n A 1 241 ASP 241 242 242 ASP ASP A . n A 1 242 ASN 242 243 243 ASN ASN A . n A 1 243 GLY 243 244 244 GLY GLY A . n A 1 244 CYS 244 245 245 CYS CYS A . n A 1 245 GLU 245 246 246 GLU GLU A . n A 1 246 ILE 246 247 247 ILE ILE A . n A 1 247 LEU 247 248 248 LEU LEU A . n A 1 248 THR 248 249 249 THR THR A . n A 1 249 LEU 249 250 250 LEU LEU A . n A 1 250 ARG 250 251 251 ARG ARG A . n A 1 251 LYS 251 252 252 LYS LYS A . n A 1 252 ASP 252 253 253 ASP ASP A . n A 1 253 ASP 253 254 254 ASP ASP A . n A 1 254 THR 254 255 255 THR THR A . n A 1 255 ILE 255 256 256 ILE ILE A . n A 1 256 PRO 256 257 257 PRO PRO A . n A 1 257 ALA 257 258 258 ALA ALA A . n A 1 258 ILE 258 259 259 ILE ILE A . n A 1 259 ILE 259 260 260 ILE ILE A . n A 1 260 SER 260 261 261 SER SER A . n A 1 261 HIS 261 262 262 HIS HIS A . n A 1 262 ASP 262 263 263 ASP ASP A . n A 1 263 GLU 263 264 264 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CO 1 301 301 CO CO A . C 2 CO 1 302 302 CO CO A . D 3 NA 1 703 703 NA NA A . E 4 U14 1 701 701 U14 U14 A . F 5 HOH 1 704 1 HOH HOH A . F 5 HOH 2 705 2 HOH HOH A . F 5 HOH 3 706 3 HOH HOH A . F 5 HOH 4 707 4 HOH HOH A . F 5 HOH 5 708 5 HOH HOH A . F 5 HOH 6 709 6 HOH HOH A . F 5 HOH 7 710 7 HOH HOH A . F 5 HOH 8 711 8 HOH HOH A . F 5 HOH 9 712 9 HOH HOH A . F 5 HOH 10 713 10 HOH HOH A . F 5 HOH 11 714 11 HOH HOH A . F 5 HOH 12 715 12 HOH HOH A . F 5 HOH 13 716 13 HOH HOH A . F 5 HOH 14 717 14 HOH HOH A . F 5 HOH 15 718 15 HOH HOH A . F 5 HOH 16 719 16 HOH HOH A . F 5 HOH 17 720 17 HOH HOH A . F 5 HOH 18 721 18 HOH HOH A . F 5 HOH 19 722 19 HOH HOH A . F 5 HOH 20 723 20 HOH HOH A . F 5 HOH 21 724 21 HOH HOH A . F 5 HOH 22 725 22 HOH HOH A . F 5 HOH 23 726 23 HOH HOH A . F 5 HOH 24 727 24 HOH HOH A . F 5 HOH 25 728 25 HOH HOH A . F 5 HOH 26 729 26 HOH HOH A . F 5 HOH 27 730 27 HOH HOH A . F 5 HOH 28 731 28 HOH HOH A . F 5 HOH 29 732 29 HOH HOH A . F 5 HOH 30 733 30 HOH HOH A . F 5 HOH 31 734 31 HOH HOH A . F 5 HOH 32 735 32 HOH HOH A . F 5 HOH 33 736 33 HOH HOH A . F 5 HOH 34 737 34 HOH HOH A . F 5 HOH 35 738 35 HOH HOH A . F 5 HOH 36 739 36 HOH HOH A . F 5 HOH 37 740 37 HOH HOH A . F 5 HOH 38 741 38 HOH HOH A . F 5 HOH 39 742 39 HOH HOH A . F 5 HOH 40 743 40 HOH HOH A . F 5 HOH 41 744 41 HOH HOH A . F 5 HOH 42 745 42 HOH HOH A . F 5 HOH 43 746 43 HOH HOH A . F 5 HOH 44 747 44 HOH HOH A . F 5 HOH 45 748 45 HOH HOH A . F 5 HOH 46 749 46 HOH HOH A . F 5 HOH 47 750 47 HOH HOH A . F 5 HOH 48 751 48 HOH HOH A . F 5 HOH 49 752 49 HOH HOH A . F 5 HOH 50 753 50 HOH HOH A . F 5 HOH 51 754 51 HOH HOH A . F 5 HOH 52 755 52 HOH HOH A . F 5 HOH 53 756 53 HOH HOH A . F 5 HOH 54 757 54 HOH HOH A . F 5 HOH 55 758 55 HOH HOH A . F 5 HOH 56 759 56 HOH HOH A . F 5 HOH 57 760 57 HOH HOH A . F 5 HOH 58 761 58 HOH HOH A . F 5 HOH 59 762 59 HOH HOH A . F 5 HOH 60 763 60 HOH HOH A . F 5 HOH 61 764 61 HOH HOH A . F 5 HOH 62 765 62 HOH HOH A . F 5 HOH 63 766 63 HOH HOH A . F 5 HOH 64 767 64 HOH HOH A . F 5 HOH 65 768 65 HOH HOH A . F 5 HOH 66 769 66 HOH HOH A . F 5 HOH 67 770 67 HOH HOH A . F 5 HOH 68 771 68 HOH HOH A . F 5 HOH 69 772 69 HOH HOH A . F 5 HOH 70 773 70 HOH HOH A . F 5 HOH 71 774 71 HOH HOH A . F 5 HOH 72 775 72 HOH HOH A . F 5 HOH 73 776 73 HOH HOH A . F 5 HOH 74 777 74 HOH HOH A . F 5 HOH 75 778 76 HOH HOH A . F 5 HOH 76 779 77 HOH HOH A . F 5 HOH 77 780 78 HOH HOH A . F 5 HOH 78 781 79 HOH HOH A . F 5 HOH 79 782 80 HOH HOH A . F 5 HOH 80 783 81 HOH HOH A . F 5 HOH 81 784 82 HOH HOH A . F 5 HOH 82 785 83 HOH HOH A . F 5 HOH 83 786 84 HOH HOH A . F 5 HOH 84 787 85 HOH HOH A . F 5 HOH 85 788 86 HOH HOH A . F 5 HOH 86 789 87 HOH HOH A . F 5 HOH 87 790 88 HOH HOH A . F 5 HOH 88 791 89 HOH HOH A . F 5 HOH 89 792 90 HOH HOH A . F 5 HOH 90 793 91 HOH HOH A . F 5 HOH 91 794 92 HOH HOH A . F 5 HOH 92 795 93 HOH HOH A . F 5 HOH 93 796 95 HOH HOH A . F 5 HOH 94 797 96 HOH HOH A . F 5 HOH 95 798 97 HOH HOH A . F 5 HOH 96 799 98 HOH HOH A . F 5 HOH 97 800 99 HOH HOH A . F 5 HOH 98 801 100 HOH HOH A . F 5 HOH 99 802 101 HOH HOH A . F 5 HOH 100 803 103 HOH HOH A . F 5 HOH 101 804 104 HOH HOH A . F 5 HOH 102 805 105 HOH HOH A . F 5 HOH 103 806 106 HOH HOH A . F 5 HOH 104 807 108 HOH HOH A . F 5 HOH 105 808 109 HOH HOH A . F 5 HOH 106 809 110 HOH HOH A . F 5 HOH 107 810 111 HOH HOH A . F 5 HOH 108 811 113 HOH HOH A . F 5 HOH 109 812 114 HOH HOH A . F 5 HOH 110 813 115 HOH HOH A . F 5 HOH 111 814 116 HOH HOH A . F 5 HOH 112 815 117 HOH HOH A . F 5 HOH 113 816 118 HOH HOH A . F 5 HOH 114 817 119 HOH HOH A . F 5 HOH 115 818 120 HOH HOH A . F 5 HOH 116 819 121 HOH HOH A . F 5 HOH 117 820 122 HOH HOH A . F 5 HOH 118 821 123 HOH HOH A . F 5 HOH 119 822 124 HOH HOH A . F 5 HOH 120 823 126 HOH HOH A . F 5 HOH 121 824 127 HOH HOH A . F 5 HOH 122 825 129 HOH HOH A . F 5 HOH 123 826 130 HOH HOH A . F 5 HOH 124 827 131 HOH HOH A . F 5 HOH 125 828 132 HOH HOH A . F 5 HOH 126 829 133 HOH HOH A . F 5 HOH 127 830 134 HOH HOH A . F 5 HOH 128 831 135 HOH HOH A . F 5 HOH 129 832 136 HOH HOH A . F 5 HOH 130 833 137 HOH HOH A . F 5 HOH 131 834 138 HOH HOH A . F 5 HOH 132 835 139 HOH HOH A . F 5 HOH 133 836 141 HOH HOH A . F 5 HOH 134 837 143 HOH HOH A . F 5 HOH 135 838 144 HOH HOH A . F 5 HOH 136 839 145 HOH HOH A . F 5 HOH 137 840 146 HOH HOH A . F 5 HOH 138 841 148 HOH HOH A . F 5 HOH 139 842 149 HOH HOH A . F 5 HOH 140 843 150 HOH HOH A . F 5 HOH 141 844 151 HOH HOH A . F 5 HOH 142 845 152 HOH HOH A . F 5 HOH 143 846 153 HOH HOH A . F 5 HOH 144 847 155 HOH HOH A . F 5 HOH 145 848 156 HOH HOH A . F 5 HOH 146 849 158 HOH HOH A . F 5 HOH 147 850 160 HOH HOH A . F 5 HOH 148 851 161 HOH HOH A . F 5 HOH 149 852 162 HOH HOH A . F 5 HOH 150 853 164 HOH HOH A . F 5 HOH 151 854 165 HOH HOH A . F 5 HOH 152 855 166 HOH HOH A . F 5 HOH 153 856 167 HOH HOH A . F 5 HOH 154 857 169 HOH HOH A . F 5 HOH 155 858 170 HOH HOH A . F 5 HOH 156 859 171 HOH HOH A . F 5 HOH 157 860 172 HOH HOH A . F 5 HOH 158 861 173 HOH HOH A . F 5 HOH 159 862 175 HOH HOH A . F 5 HOH 160 863 176 HOH HOH A . F 5 HOH 161 864 177 HOH HOH A . F 5 HOH 162 865 178 HOH HOH A . F 5 HOH 163 866 179 HOH HOH A . F 5 HOH 164 867 183 HOH HOH A . F 5 HOH 165 868 184 HOH HOH A . F 5 HOH 166 869 185 HOH HOH A . F 5 HOH 167 870 187 HOH HOH A . F 5 HOH 168 871 189 HOH HOH A . F 5 HOH 169 872 190 HOH HOH A . F 5 HOH 170 873 191 HOH HOH A . F 5 HOH 171 874 192 HOH HOH A . F 5 HOH 172 875 193 HOH HOH A . F 5 HOH 173 876 194 HOH HOH A . F 5 HOH 174 877 196 HOH HOH A . F 5 HOH 175 878 197 HOH HOH A . F 5 HOH 176 879 199 HOH HOH A . F 5 HOH 177 880 200 HOH HOH A . F 5 HOH 178 881 201 HOH HOH A . F 5 HOH 179 882 202 HOH HOH A . F 5 HOH 180 883 203 HOH HOH A . F 5 HOH 181 884 204 HOH HOH A . F 5 HOH 182 885 206 HOH HOH A . F 5 HOH 183 886 208 HOH HOH A . F 5 HOH 184 887 209 HOH HOH A . F 5 HOH 185 888 210 HOH HOH A . F 5 HOH 186 889 212 HOH HOH A . F 5 HOH 187 890 213 HOH HOH A . F 5 HOH 188 891 214 HOH HOH A . F 5 HOH 189 892 215 HOH HOH A . F 5 HOH 190 893 217 HOH HOH A . F 5 HOH 191 894 219 HOH HOH A . F 5 HOH 192 895 220 HOH HOH A . F 5 HOH 193 896 221 HOH HOH A . F 5 HOH 194 897 222 HOH HOH A . F 5 HOH 195 898 223 HOH HOH A . F 5 HOH 196 899 224 HOH HOH A . F 5 HOH 197 900 225 HOH HOH A . F 5 HOH 198 901 226 HOH HOH A . F 5 HOH 199 902 227 HOH HOH A . F 5 HOH 200 903 228 HOH HOH A . F 5 HOH 201 904 229 HOH HOH A . F 5 HOH 202 905 230 HOH HOH A . F 5 HOH 203 906 231 HOH HOH A . F 5 HOH 204 907 232 HOH HOH A . F 5 HOH 205 908 233 HOH HOH A . F 5 HOH 206 909 234 HOH HOH A . F 5 HOH 207 910 235 HOH HOH A . F 5 HOH 208 911 236 HOH HOH A . F 5 HOH 209 912 237 HOH HOH A . F 5 HOH 210 913 238 HOH HOH A . F 5 HOH 211 914 239 HOH HOH A . F 5 HOH 212 915 240 HOH HOH A . F 5 HOH 213 916 241 HOH HOH A . F 5 HOH 214 917 242 HOH HOH A . F 5 HOH 215 918 243 HOH HOH A . F 5 HOH 216 919 244 HOH HOH A . F 5 HOH 217 920 245 HOH HOH A . F 5 HOH 218 921 246 HOH HOH A . F 5 HOH 219 922 247 HOH HOH A . F 5 HOH 220 923 248 HOH HOH A . F 5 HOH 221 924 249 HOH HOH A . F 5 HOH 222 925 250 HOH HOH A . F 5 HOH 223 926 251 HOH HOH A . F 5 HOH 224 927 252 HOH HOH A . F 5 HOH 225 928 253 HOH HOH A . F 5 HOH 226 929 254 HOH HOH A . F 5 HOH 227 930 255 HOH HOH A . F 5 HOH 228 931 256 HOH HOH A . F 5 HOH 229 932 257 HOH HOH A . F 5 HOH 230 933 258 HOH HOH A . F 5 HOH 231 934 259 HOH HOH A . F 5 HOH 232 935 260 HOH HOH A . F 5 HOH 233 936 261 HOH HOH A . F 5 HOH 234 937 262 HOH HOH A . F 5 HOH 235 938 263 HOH HOH A . F 5 HOH 236 939 264 HOH HOH A . F 5 HOH 237 940 265 HOH HOH A . F 5 HOH 238 941 266 HOH HOH A . F 5 HOH 239 942 267 HOH HOH A . F 5 HOH 240 943 268 HOH HOH A . F 5 HOH 241 944 269 HOH HOH A . F 5 HOH 242 945 270 HOH HOH A . F 5 HOH 243 946 271 HOH HOH A . F 5 HOH 244 947 272 HOH HOH A . F 5 HOH 245 948 273 HOH HOH A . F 5 HOH 246 949 274 HOH HOH A . F 5 HOH 247 950 275 HOH HOH A . F 5 HOH 248 951 276 HOH HOH A . F 5 HOH 249 952 277 HOH HOH A . F 5 HOH 250 953 278 HOH HOH A . F 5 HOH 251 954 279 HOH HOH A . F 5 HOH 252 955 280 HOH HOH A . F 5 HOH 253 956 281 HOH HOH A . F 5 HOH 254 957 282 HOH HOH A . F 5 HOH 255 958 283 HOH HOH A . F 5 HOH 256 959 284 HOH HOH A . F 5 HOH 257 960 285 HOH HOH A . F 5 HOH 258 961 286 HOH HOH A . F 5 HOH 259 962 287 HOH HOH A . F 5 HOH 260 963 288 HOH HOH A . F 5 HOH 261 964 289 HOH HOH A . F 5 HOH 262 965 290 HOH HOH A . F 5 HOH 263 966 291 HOH HOH A . F 5 HOH 264 967 292 HOH HOH A . F 5 HOH 265 968 294 HOH HOH A . F 5 HOH 266 969 295 HOH HOH A . F 5 HOH 267 970 296 HOH HOH A . F 5 HOH 268 971 297 HOH HOH A . F 5 HOH 269 972 298 HOH HOH A . F 5 HOH 270 973 299 HOH HOH A . F 5 HOH 271 974 300 HOH HOH A . F 5 HOH 272 975 301 HOH HOH A . F 5 HOH 273 976 303 HOH HOH A . F 5 HOH 274 977 304 HOH HOH A . F 5 HOH 275 978 305 HOH HOH A . F 5 HOH 276 979 306 HOH HOH A . F 5 HOH 277 980 307 HOH HOH A . F 5 HOH 278 981 308 HOH HOH A . F 5 HOH 279 982 309 HOH HOH A . F 5 HOH 280 983 310 HOH HOH A . F 5 HOH 281 984 311 HOH HOH A . F 5 HOH 282 985 312 HOH HOH A . F 5 HOH 283 986 313 HOH HOH A . F 5 HOH 284 987 314 HOH HOH A . F 5 HOH 285 988 315 HOH HOH A . F 5 HOH 286 989 316 HOH HOH A . F 5 HOH 287 990 317 HOH HOH A . F 5 HOH 288 991 318 HOH HOH A . F 5 HOH 289 992 319 HOH HOH A . F 5 HOH 290 993 320 HOH HOH A . F 5 HOH 291 994 321 HOH HOH A . F 5 HOH 292 995 322 HOH HOH A . F 5 HOH 293 996 323 HOH HOH A . F 5 HOH 294 997 325 HOH HOH A . F 5 HOH 295 998 326 HOH HOH A . F 5 HOH 296 999 327 HOH HOH A . F 5 HOH 297 1000 328 HOH HOH A . F 5 HOH 298 1001 329 HOH HOH A . F 5 HOH 299 1002 330 HOH HOH A . F 5 HOH 300 1003 331 HOH HOH A . F 5 HOH 301 1004 332 HOH HOH A . F 5 HOH 302 1005 333 HOH HOH A . F 5 HOH 303 1006 335 HOH HOH A . F 5 HOH 304 1007 336 HOH HOH A . F 5 HOH 305 1008 337 HOH HOH A . F 5 HOH 306 1009 338 HOH HOH A . F 5 HOH 307 1010 340 HOH HOH A . F 5 HOH 308 1011 341 HOH HOH A . F 5 HOH 309 1012 342 HOH HOH A . F 5 HOH 310 1013 343 HOH HOH A . F 5 HOH 311 1014 344 HOH HOH A . F 5 HOH 312 1015 345 HOH HOH A . F 5 HOH 313 1016 346 HOH HOH A . F 5 HOH 314 1017 347 HOH HOH A . F 5 HOH 315 1018 348 HOH HOH A . F 5 HOH 316 1019 349 HOH HOH A . F 5 HOH 317 1020 350 HOH HOH A . F 5 HOH 318 1021 351 HOH HOH A . F 5 HOH 319 1022 352 HOH HOH A . F 5 HOH 320 1023 353 HOH HOH A . F 5 HOH 321 1024 354 HOH HOH A . F 5 HOH 322 1025 355 HOH HOH A . F 5 HOH 323 1026 356 HOH HOH A . F 5 HOH 324 1027 358 HOH HOH A . F 5 HOH 325 1028 359 HOH HOH A . F 5 HOH 326 1029 360 HOH HOH A . F 5 HOH 327 1030 361 HOH HOH A . F 5 HOH 328 1031 362 HOH HOH A . F 5 HOH 329 1032 363 HOH HOH A . F 5 HOH 330 1033 364 HOH HOH A . F 5 HOH 331 1034 365 HOH HOH A . F 5 HOH 332 1035 366 HOH HOH A . F 5 HOH 333 1036 367 HOH HOH A . F 5 HOH 334 1037 368 HOH HOH A . F 5 HOH 335 1038 369 HOH HOH A . F 5 HOH 336 1039 371 HOH HOH A . F 5 HOH 337 1040 372 HOH HOH A . F 5 HOH 338 1041 373 HOH HOH A . F 5 HOH 339 1042 376 HOH HOH A . F 5 HOH 340 1043 377 HOH HOH A . F 5 HOH 341 1044 378 HOH HOH A . F 5 HOH 342 1045 380 HOH HOH A . F 5 HOH 343 1046 382 HOH HOH A . F 5 HOH 344 1047 383 HOH HOH A . F 5 HOH 345 1048 384 HOH HOH A . F 5 HOH 346 1049 385 HOH HOH A . F 5 HOH 347 1050 386 HOH HOH A . F 5 HOH 348 1051 387 HOH HOH A . F 5 HOH 349 1052 388 HOH HOH A . F 5 HOH 350 1053 389 HOH HOH A . F 5 HOH 351 1054 390 HOH HOH A . F 5 HOH 352 1055 391 HOH HOH A . F 5 HOH 353 1056 393 HOH HOH A . F 5 HOH 354 1057 394 HOH HOH A . F 5 HOH 355 1058 395 HOH HOH A . F 5 HOH 356 1059 397 HOH HOH A . F 5 HOH 357 1060 399 HOH HOH A . F 5 HOH 358 1061 400 HOH HOH A . F 5 HOH 359 1062 401 HOH HOH A . F 5 HOH 360 1063 402 HOH HOH A . F 5 HOH 361 1064 404 HOH HOH A . F 5 HOH 362 1065 405 HOH HOH A . F 5 HOH 363 1066 406 HOH HOH A . F 5 HOH 364 1067 407 HOH HOH A . F 5 HOH 365 1068 408 HOH HOH A . F 5 HOH 366 1069 409 HOH HOH A . F 5 HOH 367 1070 410 HOH HOH A . F 5 HOH 368 1071 411 HOH HOH A . F 5 HOH 369 1072 412 HOH HOH A . F 5 HOH 370 1073 413 HOH HOH A . F 5 HOH 371 1074 414 HOH HOH A . F 5 HOH 372 1075 416 HOH HOH A . F 5 HOH 373 1076 417 HOH HOH A . F 5 HOH 374 1077 418 HOH HOH A . F 5 HOH 375 1078 419 HOH HOH A . F 5 HOH 376 1079 420 HOH HOH A . F 5 HOH 377 1080 422 HOH HOH A . F 5 HOH 378 1081 423 HOH HOH A . F 5 HOH 379 1082 424 HOH HOH A . F 5 HOH 380 1083 425 HOH HOH A . F 5 HOH 381 1084 426 HOH HOH A . F 5 HOH 382 1085 427 HOH HOH A . F 5 HOH 383 1086 429 HOH HOH A . F 5 HOH 384 1087 430 HOH HOH A . F 5 HOH 385 1088 431 HOH HOH A . F 5 HOH 386 1089 432 HOH HOH A . F 5 HOH 387 1090 433 HOH HOH A . F 5 HOH 388 1091 434 HOH HOH A . F 5 HOH 389 1092 435 HOH HOH A . F 5 HOH 390 1093 436 HOH HOH A . F 5 HOH 391 1094 437 HOH HOH A . F 5 HOH 392 1095 438 HOH HOH A . F 5 HOH 393 1096 439 HOH HOH A . F 5 HOH 394 1097 441 HOH HOH A . F 5 HOH 395 1098 442 HOH HOH A . F 5 HOH 396 1099 445 HOH HOH A . F 5 HOH 397 1100 446 HOH HOH A . F 5 HOH 398 1101 447 HOH HOH A . F 5 HOH 399 1102 448 HOH HOH A . F 5 HOH 400 1103 449 HOH HOH A . F 5 HOH 401 1104 450 HOH HOH A . F 5 HOH 402 1105 451 HOH HOH A . F 5 HOH 403 1106 453 HOH HOH A . F 5 HOH 404 1107 454 HOH HOH A . F 5 HOH 405 1108 455 HOH HOH A . F 5 HOH 406 1109 456 HOH HOH A . F 5 HOH 407 1110 457 HOH HOH A . F 5 HOH 408 1111 458 HOH HOH A . F 5 HOH 409 1112 459 HOH HOH A . F 5 HOH 410 1113 461 HOH HOH A . F 5 HOH 411 1114 462 HOH HOH A . F 5 HOH 412 1115 463 HOH HOH A . F 5 HOH 413 1116 464 HOH HOH A . F 5 HOH 414 1117 465 HOH HOH A . F 5 HOH 415 1118 466 HOH HOH A . F 5 HOH 416 1119 468 HOH HOH A . F 5 HOH 417 1120 469 HOH HOH A . F 5 HOH 418 1121 471 HOH HOH A . F 5 HOH 419 1122 472 HOH HOH A . F 5 HOH 420 1123 473 HOH HOH A . F 5 HOH 421 1124 474 HOH HOH A . F 5 HOH 422 1125 475 HOH HOH A . F 5 HOH 423 1126 476 HOH HOH A . F 5 HOH 424 1127 477 HOH HOH A . F 5 HOH 425 1128 478 HOH HOH A . F 5 HOH 426 1129 479 HOH HOH A . F 5 HOH 427 1130 483 HOH HOH A . F 5 HOH 428 1131 484 HOH HOH A . F 5 HOH 429 1132 486 HOH HOH A . F 5 HOH 430 1133 490 HOH HOH A . F 5 HOH 431 1134 491 HOH HOH A . F 5 HOH 432 1135 492 HOH HOH A . F 5 HOH 433 1136 493 HOH HOH A . F 5 HOH 434 1137 494 HOH HOH A . F 5 HOH 435 1138 495 HOH HOH A . F 5 HOH 436 1139 497 HOH HOH A . F 5 HOH 437 1140 498 HOH HOH A . F 5 HOH 438 1141 500 HOH HOH A . F 5 HOH 439 1142 501 HOH HOH A . F 5 HOH 440 1143 503 HOH HOH A . F 5 HOH 441 1144 504 HOH HOH A . F 5 HOH 442 1145 505 HOH HOH A . F 5 HOH 443 1146 506 HOH HOH A . F 5 HOH 444 1147 508 HOH HOH A . F 5 HOH 445 1148 509 HOH HOH A . F 5 HOH 446 1149 510 HOH HOH A . F 5 HOH 447 1150 511 HOH HOH A . F 5 HOH 448 1151 513 HOH HOH A . F 5 HOH 449 1152 517 HOH HOH A . F 5 HOH 450 1153 521 HOH HOH A . F 5 HOH 451 1154 525 HOH HOH A . F 5 HOH 452 1155 530 HOH HOH A . F 5 HOH 453 1156 532 HOH HOH A . F 5 HOH 454 1157 533 HOH HOH A . F 5 HOH 455 1158 535 HOH HOH A . F 5 HOH 456 1159 536 HOH HOH A . F 5 HOH 457 1160 537 HOH HOH A . F 5 HOH 458 1161 539 HOH HOH A . F 5 HOH 459 1162 540 HOH HOH A . F 5 HOH 460 1163 543 HOH HOH A . F 5 HOH 461 1164 544 HOH HOH A . F 5 HOH 462 1165 545 HOH HOH A . F 5 HOH 463 1166 548 HOH HOH A . F 5 HOH 464 1167 549 HOH HOH A . F 5 HOH 465 1168 550 HOH HOH A . F 5 HOH 466 1169 555 HOH HOH A . F 5 HOH 467 1170 556 HOH HOH A . F 5 HOH 468 1171 557 HOH HOH A . F 5 HOH 469 1172 558 HOH HOH A . F 5 HOH 470 1173 562 HOH HOH A . F 5 HOH 471 1174 563 HOH HOH A . F 5 HOH 472 1175 564 HOH HOH A . F 5 HOH 473 1176 568 HOH HOH A . F 5 HOH 474 1177 569 HOH HOH A . F 5 HOH 475 1178 570 HOH HOH A . F 5 HOH 476 1179 571 HOH HOH A . F 5 HOH 477 1180 573 HOH HOH A . F 5 HOH 478 1181 574 HOH HOH A . F 5 HOH 479 1182 577 HOH HOH A . F 5 HOH 480 1183 578 HOH HOH A . F 5 HOH 481 1184 580 HOH HOH A . F 5 HOH 482 1185 582 HOH HOH A . F 5 HOH 483 1186 583 HOH HOH A . F 5 HOH 484 1187 586 HOH HOH A . F 5 HOH 485 1188 592 HOH HOH A . F 5 HOH 486 1189 596 HOH HOH A . F 5 HOH 487 1190 615 HOH HOH A . F 5 HOH 488 1191 617 HOH HOH A . F 5 HOH 489 1192 618 HOH HOH A . F 5 HOH 490 1193 619 HOH HOH A . F 5 HOH 491 1194 620 HOH HOH A . F 5 HOH 492 1195 621 HOH HOH A . F 5 HOH 493 1196 622 HOH HOH A . F 5 HOH 494 1197 623 HOH HOH A . F 5 HOH 495 1198 624 HOH HOH A . F 5 HOH 496 1199 625 HOH HOH A . F 5 HOH 497 1200 626 HOH HOH A . F 5 HOH 498 1201 627 HOH HOH A . F 5 HOH 499 1202 628 HOH HOH A . F 5 HOH 500 1203 629 HOH HOH A . F 5 HOH 501 1204 630 HOH HOH A . F 5 HOH 502 1205 631 HOH HOH A . F 5 HOH 503 1206 632 HOH HOH A . F 5 HOH 504 1207 633 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ASN 73 ? A ASN 74 ? 1_555 NA ? D NA . ? A NA 703 ? 1_555 O ? A VAL 75 ? A VAL 76 ? 1_555 97.8 ? 2 O ? A ASN 73 ? A ASN 74 ? 1_555 NA ? D NA . ? A NA 703 ? 1_555 O ? A SER 230 ? A SER 231 ? 1_555 94.5 ? 3 O ? A VAL 75 ? A VAL 76 ? 1_555 NA ? D NA . ? A NA 703 ? 1_555 O ? A SER 230 ? A SER 231 ? 1_555 129.2 ? 4 O ? A ASN 73 ? A ASN 74 ? 1_555 NA ? D NA . ? A NA 703 ? 1_555 O ? F HOH . ? A HOH 793 ? 1_555 138.9 ? 5 O ? A VAL 75 ? A VAL 76 ? 1_555 NA ? D NA . ? A NA 703 ? 1_555 O ? F HOH . ? A HOH 793 ? 1_555 107.5 ? 6 O ? A SER 230 ? A SER 231 ? 1_555 NA ? D NA . ? A NA 703 ? 1_555 O ? F HOH . ? A HOH 793 ? 1_555 93.8 ? 7 OD1 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OD2 ? A ASP 96 ? A ASP 97 ? 1_555 56.3 ? 8 OD1 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OD1 ? A ASP 107 ? A ASP 108 ? 1_555 107.3 ? 9 OD2 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OD1 ? A ASP 107 ? A ASP 108 ? 1_555 162.7 ? 10 OD1 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OE1 A A GLU 234 ? A GLU 235 ? 1_555 114.6 ? 11 OD2 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OE1 A A GLU 234 ? A GLU 235 ? 1_555 89.7 ? 12 OD1 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OE1 A A GLU 234 ? A GLU 235 ? 1_555 93.3 ? 13 OD1 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OE1 B A GLU 234 ? A GLU 235 ? 1_555 93.2 ? 14 OD2 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OE1 B A GLU 234 ? A GLU 235 ? 1_555 85.7 ? 15 OD1 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OE1 B A GLU 234 ? A GLU 235 ? 1_555 90.3 ? 16 OE1 A A GLU 234 ? A GLU 235 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OE1 B A GLU 234 ? A GLU 235 ? 1_555 23.8 ? 17 OD1 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OE2 B A GLU 234 ? A GLU 235 ? 1_555 144.0 ? 18 OD2 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OE2 B A GLU 234 ? A GLU 235 ? 1_555 94.7 ? 19 OD1 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OE2 B A GLU 234 ? A GLU 235 ? 1_555 98.0 ? 20 OE1 A A GLU 234 ? A GLU 235 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OE2 B A GLU 234 ? A GLU 235 ? 1_555 37.1 ? 21 OE1 B A GLU 234 ? A GLU 235 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OE2 B A GLU 234 ? A GLU 235 ? 1_555 60.9 ? 22 OD1 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 N3 ? E U14 . ? A U14 701 ? 1_555 107.8 ? 23 OD2 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 N3 ? E U14 . ? A U14 701 ? 1_555 85.8 ? 24 OD1 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 N3 ? E U14 . ? A U14 701 ? 1_555 106.2 ? 25 OE1 A A GLU 234 ? A GLU 235 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 N3 ? E U14 . ? A U14 701 ? 1_555 124.9 ? 26 OE1 B A GLU 234 ? A GLU 235 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 N3 ? E U14 . ? A U14 701 ? 1_555 147.4 ? 27 OE2 B A GLU 234 ? A GLU 235 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 N3 ? E U14 . ? A U14 701 ? 1_555 88.6 ? 28 OD2 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 NE2 ? A HIS 170 ? A HIS 171 ? 1_555 89.3 ? 29 OD2 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE2 A A GLU 203 ? A GLU 204 ? 1_555 153.0 ? 30 NE2 ? A HIS 170 ? A HIS 171 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE2 A A GLU 203 ? A GLU 204 ? 1_555 85.7 ? 31 OD2 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE2 B A GLU 203 ? A GLU 204 ? 1_555 132.4 ? 32 NE2 ? A HIS 170 ? A HIS 171 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE2 B A GLU 203 ? A GLU 204 ? 1_555 94.5 ? 33 OE2 A A GLU 203 ? A GLU 204 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE2 B A GLU 203 ? A GLU 204 ? 1_555 22.7 ? 34 OD2 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE2 A A GLU 234 ? A GLU 235 ? 1_555 78.0 ? 35 NE2 ? A HIS 170 ? A HIS 171 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE2 A A GLU 234 ? A GLU 235 ? 1_555 128.1 ? 36 OE2 A A GLU 203 ? A GLU 204 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE2 A A GLU 234 ? A GLU 235 ? 1_555 84.4 ? 37 OE2 B A GLU 203 ? A GLU 204 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE2 A A GLU 234 ? A GLU 235 ? 1_555 62.7 ? 38 OD2 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE2 B A GLU 234 ? A GLU 235 ? 1_555 94.4 ? 39 NE2 ? A HIS 170 ? A HIS 171 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE2 B A GLU 234 ? A GLU 235 ? 1_555 168.9 ? 40 OE2 A A GLU 203 ? A GLU 204 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE2 B A GLU 234 ? A GLU 235 ? 1_555 86.3 ? 41 OE2 B A GLU 203 ? A GLU 204 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE2 B A GLU 234 ? A GLU 235 ? 1_555 75.3 ? 42 OE2 A A GLU 234 ? A GLU 235 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE2 B A GLU 234 ? A GLU 235 ? 1_555 43.2 ? 43 OD2 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 N2 ? E U14 . ? A U14 701 ? 1_555 97.6 ? 44 NE2 ? A HIS 170 ? A HIS 171 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 N2 ? E U14 . ? A U14 701 ? 1_555 109.0 ? 45 OE2 A A GLU 203 ? A GLU 204 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 N2 ? E U14 . ? A U14 701 ? 1_555 109.1 ? 46 OE2 B A GLU 203 ? A GLU 204 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 N2 ? E U14 . ? A U14 701 ? 1_555 125.2 ? 47 OE2 A A GLU 234 ? A GLU 235 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 N2 ? E U14 . ? A U14 701 ? 1_555 122.4 ? 48 OE2 B A GLU 234 ? A GLU 235 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 N2 ? E U14 . ? A U14 701 ? 1_555 81.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-13 2 'Structure model' 1 1 2008-04-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_initial_refinement_model 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_alt_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_alt_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 22 4 'Structure model' '_pdbx_struct_conn_angle.value' 23 4 'Structure model' '_struct_conn.pdbx_dist_value' 24 4 'Structure model' '_struct_conn.pdbx_ptnr1_label_alt_id' 25 4 'Structure model' '_struct_conn.pdbx_ptnr2_label_alt_id' 26 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 27 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 28 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 29 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 30 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 31 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 32 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 33 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 34 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 35 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 36 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 37 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 38 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 39 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 40 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 1 PDB_EXTRACT 1.701 'Nov. 1, 2005' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 2 ADSC . ? ? ? ? 'data collection' ? ? ? 3 SCALEPACK . ? ? ? ? 'data scaling' ? ? ? 4 AMoRE . ? ? ? ? phasing ? ? ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 860 ? ? O A HOH 1096 ? ? 2.08 2 1 O A HOH 851 ? ? O A HOH 1206 ? ? 2.13 3 1 O A HOH 1055 ? ? O A HOH 1163 ? ? 2.19 4 1 NZ A LYS 196 ? B O A HOH 1207 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 1089 ? ? 1_555 O A HOH 1193 ? ? 2_656 1.83 2 1 OE2 A GLU 160 ? ? 1_555 O A HOH 1158 ? ? 2_646 2.15 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 124 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 124 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 124 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.21 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.09 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 74 ? ? 60.17 -116.23 2 1 ASN A 192 ? ? -151.12 83.39 3 1 GLU A 204 ? ? -159.87 62.71 4 1 GLU A 204 ? ? -157.74 58.58 5 1 TRP A 221 ? ? -128.79 -50.94 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CO CO CO N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 NA NA NA N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 U14 O2 O N N 374 U14 C4 C N N 375 U14 O1 O N N 376 U14 C9 C Y N 377 U14 C6 C Y N 378 U14 C10 C Y N 379 U14 C7 C Y N 380 U14 C8 C Y N 381 U14 C5 C Y N 382 U14 N6 N N N 383 U14 N5 N N N 384 U14 C2 C N N 385 U14 C3 C N N 386 U14 N4 N N N 387 U14 N2 N N N 388 U14 C1 C N N 389 U14 N3 N N N 390 U14 N1 N N N 391 U14 HO1 H N N 392 U14 H6 H N N 393 U14 H10 H N N 394 U14 H7 H N N 395 U14 H8 H N N 396 U14 HN41 H N N 397 U14 HN42 H N N 398 U14 HN12 H N N 399 VAL N N N N 400 VAL CA C N S 401 VAL C C N N 402 VAL O O N N 403 VAL CB C N N 404 VAL CG1 C N N 405 VAL CG2 C N N 406 VAL OXT O N N 407 VAL H H N N 408 VAL H2 H N N 409 VAL HA H N N 410 VAL HB H N N 411 VAL HG11 H N N 412 VAL HG12 H N N 413 VAL HG13 H N N 414 VAL HG21 H N N 415 VAL HG22 H N N 416 VAL HG23 H N N 417 VAL HXT H N N 418 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 U14 O2 C4 doub N N 358 U14 C4 O1 sing N N 359 U14 C4 C9 sing N N 360 U14 O1 HO1 sing N N 361 U14 C9 C6 sing Y N 362 U14 C9 C8 doub Y N 363 U14 C6 C10 doub Y N 364 U14 C6 H6 sing N N 365 U14 C10 C7 sing Y N 366 U14 C10 H10 sing N N 367 U14 C7 C5 doub Y N 368 U14 C7 H7 sing N N 369 U14 C8 C5 sing Y N 370 U14 C8 H8 sing N N 371 U14 C5 N6 sing N N 372 U14 N6 N5 doub N E 373 U14 N5 C2 sing N N 374 U14 C2 C3 doub N N 375 U14 C2 C1 sing N N 376 U14 C3 N4 sing N N 377 U14 C3 N2 sing N N 378 U14 N4 HN41 sing N N 379 U14 N4 HN42 sing N N 380 U14 N2 N3 doub N N 381 U14 C1 N3 sing N N 382 U14 C1 N1 doub N Z 383 U14 N1 HN12 sing N N 384 VAL N CA sing N N 385 VAL N H sing N N 386 VAL N H2 sing N N 387 VAL CA C sing N N 388 VAL CA CB sing N N 389 VAL CA HA sing N N 390 VAL C O doub N N 391 VAL C OXT sing N N 392 VAL CB CG1 sing N N 393 VAL CB CG2 sing N N 394 VAL CB HB sing N N 395 VAL CG1 HG11 sing N N 396 VAL CG1 HG12 sing N N 397 VAL CG1 HG13 sing N N 398 VAL CG2 HG21 sing N N 399 VAL CG2 HG22 sing N N 400 VAL CG2 HG23 sing N N 401 VAL OXT HXT sing N N 402 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COBALT (II) ION' CO 3 'SODIUM ION' NA 4 '3-(5-AMINO-3-IMINO-3H-PYRAZOL-4-YLAZO)-BENZOIC ACID' U14 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2GG2 _pdbx_initial_refinement_model.details 'PDB ENTRY 2GG2' #