data_2GQI # _entry.id 2GQI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2GQI pdb_00002gqi 10.2210/pdb2gqi/pdb RCSB RCSB037430 ? ? WWPDB D_1000037430 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2GQI _pdbx_database_status.recvd_initial_deposition_date 2006-04-21 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kurosaki, C.' 1 'Hayashi, F.' 2 'Yoshida, M.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the SH3 domain of human Ras GTPase-activating protein 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kurosaki, C.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yoshida, M.' 3 ? primary 'Yokoyama, S.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ras GTPase-activating protein 1' _entity.formula_weight 7831.655 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GTPase-activating protein, GAP, Ras p21 protein activator, p120GAP, RasGAP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ARG n 1 9 ARG n 1 10 VAL n 1 11 ARG n 1 12 ALA n 1 13 ILE n 1 14 LEU n 1 15 PRO n 1 16 TYR n 1 17 THR n 1 18 LYS n 1 19 VAL n 1 20 PRO n 1 21 ASP n 1 22 THR n 1 23 ASP n 1 24 GLU n 1 25 ILE n 1 26 SER n 1 27 PHE n 1 28 LEU n 1 29 LYS n 1 30 GLY n 1 31 ASP n 1 32 MET n 1 33 PHE n 1 34 ILE n 1 35 VAL n 1 36 HIS n 1 37 ASN n 1 38 GLU n 1 39 LEU n 1 40 GLU n 1 41 ASP n 1 42 GLY n 1 43 TRP n 1 44 MET n 1 45 TRP n 1 46 VAL n 1 47 THR n 1 48 ASN n 1 49 LEU n 1 50 ARG n 1 51 THR n 1 52 ASP n 1 53 GLU n 1 54 GLN n 1 55 GLY n 1 56 LEU n 1 57 ILE n 1 58 VAL n 1 59 GLU n 1 60 ASP n 1 61 LEU n 1 62 VAL n 1 63 GLU n 1 64 GLU n 1 65 VAL n 1 66 SER n 1 67 GLY n 1 68 PRO n 1 69 SER n 1 70 SER n 1 71 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'RASA1, RASA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050711-04 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RASA1_HUMAN _struct_ref.pdbx_db_accession P20936 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEV _struct_ref.pdbx_align_begin 282 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2GQI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 65 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P20936 _struct_ref_seq.db_align_beg 282 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 339 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 65 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2GQI GLY A 1 ? UNP P20936 ? ? 'cloning artifact' 1 1 1 2GQI SER A 2 ? UNP P20936 ? ? 'cloning artifact' 2 2 1 2GQI SER A 3 ? UNP P20936 ? ? 'cloning artifact' 3 3 1 2GQI GLY A 4 ? UNP P20936 ? ? 'cloning artifact' 4 4 1 2GQI SER A 5 ? UNP P20936 ? ? 'cloning artifact' 5 5 1 2GQI SER A 6 ? UNP P20936 ? ? 'cloning artifact' 6 6 1 2GQI GLY A 7 ? UNP P20936 ? ? 'cloning artifact' 7 7 1 2GQI SER A 66 ? UNP P20936 ? ? 'cloning artifact' 66 8 1 2GQI GLY A 67 ? UNP P20936 ? ? 'cloning artifact' 67 9 1 2GQI PRO A 68 ? UNP P20936 ? ? 'cloning artifact' 68 10 1 2GQI SER A 69 ? UNP P20936 ? ? 'cloning artifact' 69 11 1 2GQI SER A 70 ? UNP P20936 ? ? 'cloning artifact' 70 12 1 2GQI GLY A 71 ? UNP P20936 ? ? 'cloning artifact' 71 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.17mM 13C, 15N-labeled protein; 20mM d-Tris-HCl (pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3, 10% D2O; 90% H2O' _pdbx_nmr_sample_details.solvent_system '10% D2O; 90% H2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 ECA JEOL 800 ? 2 ECA JEOL 700 ? # _pdbx_nmr_refine.entry_id 2GQI _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2GQI _pdbx_nmr_details.text 'spectrometer_id 1 for 3D_15N-separated_NOESY; spectrometer_id 2 for 3D_13C-separated_NOESY' # _pdbx_nmr_ensemble.entry_id 2GQI _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2GQI _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection 'Delta NMR' 4.3.2 JEOL 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.934 'KOBAYASHI, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2GQI _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2GQI _struct.title 'Solution structure of the SH3 domain of human Ras GTPase-activating protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2GQI _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;GTPase-activating protein, GAP, Ras p21 protein activator, p120GAP, RasGAP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 10 ? ALA A 12 ? VAL A 10 ALA A 12 A 2 VAL A 62 ? GLU A 64 ? VAL A 62 GLU A 64 B 1 ASN A 37 ? GLU A 38 ? ASN A 37 GLU A 38 B 2 MET A 44 ? THR A 47 ? MET A 44 THR A 47 B 3 GLN A 54 ? ILE A 57 ? GLN A 54 ILE A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 11 ? N ARG A 11 O GLU A 63 ? O GLU A 63 B 1 2 N ASN A 37 ? N ASN A 37 O TRP A 45 ? O TRP A 45 B 2 3 N VAL A 46 ? N VAL A 46 O GLY A 55 ? O GLY A 55 # _database_PDB_matrix.entry_id 2GQI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2GQI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 TRP 45 45 45 TRP TRP A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 GLY 71 71 71 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-21 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 18 ? ? -36.64 151.62 2 1 ASP A 21 ? ? 72.77 51.17 3 1 GLU A 24 ? ? -37.81 152.59 4 2 LYS A 18 ? ? -46.28 169.43 5 2 LYS A 29 ? ? -51.09 105.78 6 3 ALA A 12 ? ? -69.09 95.33 7 3 LYS A 29 ? ? -59.82 104.32 8 3 ASN A 48 ? ? -37.75 139.97 9 4 LYS A 18 ? ? -35.18 146.77 10 4 ASP A 21 ? ? 73.98 40.72 11 4 GLU A 24 ? ? -34.63 139.37 12 4 TRP A 45 ? ? -59.83 98.97 13 5 SER A 2 ? ? 37.86 49.48 14 5 LYS A 18 ? ? -40.52 155.45 15 5 TRP A 45 ? ? -62.10 93.14 16 5 ASN A 48 ? ? -47.13 150.52 17 6 LYS A 29 ? ? -38.53 136.32 18 6 ASP A 31 ? ? -34.52 125.12 19 6 TRP A 45 ? ? -69.86 89.99 20 6 PRO A 68 ? ? -69.79 1.38 21 6 SER A 70 ? ? -35.14 116.08 22 7 SER A 2 ? ? -64.22 85.10 23 7 SER A 5 ? ? -59.07 102.27 24 7 LYS A 18 ? ? -48.84 162.91 25 7 VAL A 35 ? ? -59.40 109.82 26 7 TRP A 45 ? ? -64.71 86.31 27 8 SER A 2 ? ? 35.79 42.23 28 8 ARG A 8 ? ? -41.73 155.07 29 8 LYS A 18 ? ? -43.50 156.11 30 8 ASP A 21 ? ? 70.50 40.08 31 8 TRP A 45 ? ? -59.30 91.50 32 8 PRO A 68 ? ? -69.75 0.18 33 9 SER A 3 ? ? -58.27 109.53 34 9 VAL A 35 ? ? -52.96 100.35 35 9 TRP A 45 ? ? -67.30 96.32 36 9 PRO A 68 ? ? -69.82 1.17 37 9 SER A 70 ? ? -35.97 107.87 38 10 LYS A 18 ? ? -37.42 154.12 39 11 LYS A 18 ? ? -39.79 151.85 40 11 ASP A 21 ? ? 71.71 51.23 41 11 GLU A 24 ? ? -37.25 147.52 42 11 VAL A 35 ? ? -50.66 109.90 43 11 TRP A 45 ? ? -63.81 93.92 44 12 ARG A 8 ? ? -37.43 121.56 45 12 TRP A 45 ? ? -68.53 89.02 46 12 PRO A 68 ? ? -69.75 94.93 47 13 SER A 3 ? ? -37.07 146.79 48 13 ALA A 12 ? ? -67.69 94.80 49 13 ASP A 21 ? ? 72.62 45.97 50 13 VAL A 35 ? ? -39.95 117.09 51 14 ALA A 12 ? ? -68.18 94.59 52 14 GLU A 24 ? ? -38.26 137.05 53 14 TRP A 43 ? ? -52.95 173.95 54 14 TRP A 45 ? ? -63.65 86.13 55 15 LYS A 18 ? ? -43.18 163.78 56 15 ASP A 21 ? ? 71.37 37.30 57 15 ASP A 41 ? ? -39.02 -25.93 58 15 TRP A 45 ? ? -62.45 95.50 59 15 PRO A 68 ? ? -69.85 2.85 60 15 SER A 70 ? ? -37.15 143.58 61 16 ALA A 12 ? ? -63.73 95.47 62 16 LYS A 18 ? ? -36.61 144.24 63 16 ASP A 21 ? ? 72.99 52.88 64 16 ASP A 31 ? ? -38.92 127.88 65 16 TRP A 45 ? ? -67.30 85.86 66 17 SER A 2 ? ? -130.30 -47.53 67 17 TRP A 45 ? ? -67.14 84.12 68 17 ASN A 48 ? ? -39.25 148.71 69 17 VAL A 65 ? ? -100.90 65.44 70 18 SER A 5 ? ? -64.93 85.64 71 18 LYS A 18 ? ? -39.69 148.01 72 18 VAL A 65 ? ? -122.44 -60.93 73 19 SER A 5 ? ? -101.44 48.14 74 19 SER A 6 ? ? 39.32 36.03 75 19 ASP A 21 ? ? 72.49 36.76 76 19 VAL A 35 ? ? -58.82 98.66 77 19 TRP A 45 ? ? -65.22 93.08 78 19 ASN A 48 ? ? -36.58 139.63 79 20 SER A 6 ? ? -95.31 -63.87 80 20 ASP A 21 ? ? 74.52 33.32 81 20 TRP A 45 ? ? -61.00 95.11 82 20 VAL A 65 ? ? -95.64 31.10 #