data_2GVB # _entry.id 2GVB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2GVB pdb_00002gvb 10.2210/pdb2gvb/pdb WWPDB D_1000178160 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 1995-10-15 _pdbx_database_PDB_obs_spr.pdb_id 2GVB _pdbx_database_PDB_obs_spr.replace_pdb_id 1GVB _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2GVA _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2GVB _pdbx_database_status.recvd_initial_deposition_date 1995-07-27 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Folkers, P.J.M.' 1 'Nilges, M.' 2 'Folmer, R.H.A.' 3 'Prompers, J.J.' 4 'Konings, R.N.H.' 5 'Hilbers, C.W.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Refined solution structure of the Tyr41-->His mutant of the M13 gene V protein. A comparison with the crystal structure.' Eur.J.Biochem. 232 506 514 1995 EJBCAI IX 0014-2956 0262 ? 7556200 10.1111/j.1432-1033.1995.506zz.x 1 ;The Solution Structure of the Tyr 41--> His Mutant of the Single-Stranded DNA Binding Protein Encoded by Gene V of the Filamentous Bacteriophage M13 ; J.Mol.Biol. 236 229 ? 1994 JMOBAK UK 0022-2836 0070 ? ? ? 2 ;Exploring the DNA Binding Domain of Gene V Protein Encoded by Bacteriophage M13 with the Aid of Spin-Labeled Oligonucleotides in Combination with H-NMR ; Biochemistry 32 9407 ? 1993 BICHAW US 0006-2960 0033 ? ? ? 3 ;Sequence-Specific H-NMR Assignment and Secondary Structure of the Tyr 41--> His Mutant of the Single-Stranded DNA Binding Protein, Gene V Protein, Encoded by the Filamentous Bacteriophage M13 ; Eur.J.Biochem. 202 349 ? 1991 EJBCAI IX 0014-2956 0262 ? ? ? 4 'Characterization of Wild-Type and Mutant M13 Gene V Proteins by Means of H-NMR' Eur.J.Biochem. 200 139 ? 1991 EJBCAI IX 0014-2956 0262 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Prompers, J.J.' 1 ? primary 'Folmer, R.H.' 2 ? primary 'Nilges, M.' 3 ? primary 'Folkers, P.J.' 4 ? primary 'Konings, R.N.' 5 ? primary 'Hilbers, C.W.' 6 ? 1 'Folkers, P.J.M.' 7 ? 1 'Nilges, M.' 8 ? 1 'Folmer, R.H.A.' 9 ? 1 'Konings, R.N.H.' 10 ? 1 'Hilbers, C.W.' 11 ? 2 'Folkers, P.J.M.' 12 ? 2 'Van Duynhoven, J.P.M.' 13 ? 2 'Van Lieshout, H.T.M.' 14 ? 2 'Harmsen, B.J.M.' 15 ? 2 'Van Boom, J.H.' 16 ? 2 'Tesser, G.I.' 17 ? 2 'Konings, R.N.H.' 18 ? 2 'Hilbers, C.W.' 19 ? 3 'Folkers, P.J.M.' 20 ? 3 'Van Duynhoven, J.P.M.' 21 ? 3 'Jonker, A.J.' 22 ? 3 'Harmsen, B.J.M.' 23 ? 3 'Konings, R.N.H.' 24 ? 3 'Hilbers, C.W.' 25 ? 4 'Folkers, P.J.M.' 26 ? 4 'Stassen, A.P.M.' 27 ? 4 'Van Duynhoven, J.P.M.' 28 ? 4 'Harmsen, B.J.M.' 29 ? 4 'Konings, R.N.H.' 30 ? 4 'Hilbers, C.W.' 31 ? # _cell.entry_id 2GVB _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2GVB _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'GENE V PROTEIN' _entity.formula_weight 9674.188 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation Y41H _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDR LRLVPAK ; _entity_poly.pdbx_seq_one_letter_code_can ;MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDR LRLVPAK ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 LYS n 1 4 VAL n 1 5 GLU n 1 6 ILE n 1 7 LYS n 1 8 PRO n 1 9 SER n 1 10 GLN n 1 11 ALA n 1 12 GLN n 1 13 PHE n 1 14 THR n 1 15 THR n 1 16 ARG n 1 17 SER n 1 18 GLY n 1 19 VAL n 1 20 SER n 1 21 ARG n 1 22 GLN n 1 23 GLY n 1 24 LYS n 1 25 PRO n 1 26 TYR n 1 27 SER n 1 28 LEU n 1 29 ASN n 1 30 GLU n 1 31 GLN n 1 32 LEU n 1 33 CYS n 1 34 TYR n 1 35 VAL n 1 36 ASP n 1 37 LEU n 1 38 GLY n 1 39 ASN n 1 40 GLU n 1 41 HIS n 1 42 PRO n 1 43 VAL n 1 44 LEU n 1 45 VAL n 1 46 LYS n 1 47 ILE n 1 48 THR n 1 49 LEU n 1 50 ASP n 1 51 GLU n 1 52 GLY n 1 53 GLN n 1 54 PRO n 1 55 ALA n 1 56 TYR n 1 57 ALA n 1 58 PRO n 1 59 GLY n 1 60 LEU n 1 61 TYR n 1 62 THR n 1 63 VAL n 1 64 HIS n 1 65 LEU n 1 66 SER n 1 67 SER n 1 68 PHE n 1 69 LYS n 1 70 VAL n 1 71 GLY n 1 72 GLN n 1 73 PHE n 1 74 GLY n 1 75 SER n 1 76 LEU n 1 77 MET n 1 78 ILE n 1 79 ASP n 1 80 ARG n 1 81 LEU n 1 82 ARG n 1 83 LEU n 1 84 VAL n 1 85 PRO n 1 86 ALA n 1 87 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Inovirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage M13' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10870 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name M13 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VHED_BPM13 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P69544 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDR LRLVPAK ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2GVB A 1 ? 87 ? P69544 1 ? 87 ? 1 87 2 1 2GVB B 1 ? 87 ? P69544 1 ? 87 ? 1 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2GVB HIS A 41 ? UNP P69544 TYR 41 conflict 41 1 2 2GVB HIS B 41 ? UNP P69544 TYR 41 conflict 41 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 2GVB _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DIANA ? GUNTERT,BRAUN,WUTHRICH 1 refinement X-PLOR ? BRUNGER 2 # _exptl.entry_id 2GVB _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2GVB _struct.title 'REFINED SOLUTION STRUCTURE OF THE TYR 41--> HIS MUTANT OF THE M13 GENE V PROTEIN. A COMPARISON WITH THE CRYSTAL STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2GVB _struct_keywords.pdbx_keywords 'DNA-BINDING (VIRAL)' _struct_keywords.text 'DNA-BINDING (VIRAL)' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1A LYS A 7 ? SER A 9 ? LYS A 7 SER A 9 5 ? 3 HELX_P HELX_P2 H2A HIS A 64 ? SER A 67 ? HIS A 64 SER A 67 5 ? 4 HELX_P HELX_P3 H1B LYS B 7 ? SER B 9 ? LYS B 7 SER B 9 5 ? 3 HELX_P HELX_P4 H2B HIS B 64 ? SER B 67 ? HIS B 64 SER B 67 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details S1A ? 5 ? S1B ? 5 ? S2A ? 2 ? S1C ? 5 ? S1D ? 5 ? S2B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1A 1 2 ? anti-parallel S1A 2 3 ? anti-parallel S1A 3 4 ? anti-parallel S1A 4 5 ? anti-parallel S1B 1 2 ? anti-parallel S1B 2 3 ? anti-parallel S1B 3 4 ? anti-parallel S1B 4 5 ? anti-parallel S2A 1 2 ? anti-parallel S1C 1 2 ? anti-parallel S1C 2 3 ? anti-parallel S1C 3 4 ? anti-parallel S1C 4 5 ? anti-parallel S1D 1 2 ? anti-parallel S1D 2 3 ? anti-parallel S1D 3 4 ? anti-parallel S1D 4 5 ? anti-parallel S2B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1A 1 PRO A 42 ? THR A 48 ? PRO A 42 THR A 48 S1A 2 LYS A 24 ? ASP A 36 ? LYS A 24 ASP A 36 S1A 3 LYS A 3 ? ILE A 6 ? LYS A 3 ILE A 6 S1A 4 GLY A 59 ? HIS A 64 ? GLY A 59 HIS A 64 S1A 5 ARG A 82 ? ALA A 86 ? ARG A 82 ALA A 86 S1B 1 PHE A 13 ? SER A 20 ? PHE A 13 SER A 20 S1B 2 LYS A 24 ? ASP A 36 ? LYS A 24 ASP A 36 S1B 3 LYS A 3 ? ILE A 6 ? LYS A 3 ILE A 6 S1B 4 GLY A 59 ? HIS A 64 ? GLY A 59 HIS A 64 S1B 5 ARG A 82 ? ALA A 86 ? ARG A 82 ALA A 86 S2A 1 PHE A 68 ? GLY A 71 ? PHE A 68 GLY A 71 S2A 2 SER A 75 ? ILE A 78 ? SER A 75 ILE A 78 S1C 1 PRO B 42 ? THR B 48 ? PRO B 42 THR B 48 S1C 2 LYS B 24 ? ASP B 36 ? LYS B 24 ASP B 36 S1C 3 LYS B 3 ? ILE B 6 ? LYS B 3 ILE B 6 S1C 4 GLY B 59 ? HIS B 64 ? GLY B 59 HIS B 64 S1C 5 ARG B 82 ? ALA B 86 ? ARG B 82 ALA B 86 S1D 1 PHE B 13 ? SER B 20 ? PHE B 13 SER B 20 S1D 2 LYS B 24 ? ASP B 36 ? LYS B 24 ASP B 36 S1D 3 LYS B 3 ? ILE B 6 ? LYS B 3 ILE B 6 S1D 4 GLY B 59 ? HIS B 64 ? GLY B 59 HIS B 64 S1D 5 ARG B 82 ? ALA B 86 ? ARG B 82 ALA B 86 S2B 1 PHE B 68 ? GLY B 71 ? PHE B 68 GLY B 71 S2B 2 SER B 75 ? ILE B 78 ? SER B 75 ILE B 78 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1A 1 2 N VAL A 43 ? N VAL A 43 O VAL A 35 ? O VAL A 35 S1A 2 3 N TYR A 34 ? N TYR A 34 O GLU A 5 ? O GLU A 5 S1A 3 4 N VAL A 4 ? N VAL A 4 O TYR A 61 ? O TYR A 61 S1A 4 5 N HIS A 64 ? N HIS A 64 O ARG A 82 ? O ARG A 82 S1B 1 2 N GLY A 18 ? N GLY A 18 O TYR A 26 ? O TYR A 26 S1B 2 3 N TYR A 34 ? N TYR A 34 O GLU A 5 ? O GLU A 5 S1B 3 4 N VAL A 4 ? N VAL A 4 O TYR A 61 ? O TYR A 61 S1B 4 5 N HIS A 64 ? N HIS A 64 O ARG A 82 ? O ARG A 82 S2A 1 2 N LYS A 69 ? N LYS A 69 O MET A 77 ? O MET A 77 S1C 1 2 N VAL B 43 ? N VAL B 43 O VAL B 35 ? O VAL B 35 S1C 2 3 N TYR B 34 ? N TYR B 34 O GLU B 5 ? O GLU B 5 S1C 3 4 N VAL B 4 ? N VAL B 4 O TYR B 61 ? O TYR B 61 S1C 4 5 N HIS B 64 ? N HIS B 64 O ARG B 82 ? O ARG B 82 S1D 1 2 N GLY B 18 ? N GLY B 18 O TYR B 26 ? O TYR B 26 S1D 2 3 N TYR B 34 ? N TYR B 34 O GLU B 5 ? O GLU B 5 S1D 3 4 N VAL B 4 ? N VAL B 4 O TYR B 61 ? O TYR B 61 S1D 4 5 N HIS B 64 ? N HIS B 64 O ARG B 82 ? O ARG B 82 S2B 1 2 N LYS B 69 ? N LYS B 69 O MET B 77 ? O MET B 77 # _database_PDB_matrix.entry_id 2GVB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2GVB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 LYS 87 87 87 LYS LYS A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 ILE 2 2 2 ILE ILE B . n B 1 3 LYS 3 3 3 LYS LYS B . n B 1 4 VAL 4 4 4 VAL VAL B . n B 1 5 GLU 5 5 5 GLU GLU B . n B 1 6 ILE 6 6 6 ILE ILE B . n B 1 7 LYS 7 7 7 LYS LYS B . n B 1 8 PRO 8 8 8 PRO PRO B . n B 1 9 SER 9 9 9 SER SER B . n B 1 10 GLN 10 10 10 GLN GLN B . n B 1 11 ALA 11 11 11 ALA ALA B . n B 1 12 GLN 12 12 12 GLN GLN B . n B 1 13 PHE 13 13 13 PHE PHE B . n B 1 14 THR 14 14 14 THR THR B . n B 1 15 THR 15 15 15 THR THR B . n B 1 16 ARG 16 16 16 ARG ARG B . n B 1 17 SER 17 17 17 SER SER B . n B 1 18 GLY 18 18 18 GLY GLY B . n B 1 19 VAL 19 19 19 VAL VAL B . n B 1 20 SER 20 20 20 SER SER B . n B 1 21 ARG 21 21 21 ARG ARG B . n B 1 22 GLN 22 22 22 GLN GLN B . n B 1 23 GLY 23 23 23 GLY GLY B . n B 1 24 LYS 24 24 24 LYS LYS B . n B 1 25 PRO 25 25 25 PRO PRO B . n B 1 26 TYR 26 26 26 TYR TYR B . n B 1 27 SER 27 27 27 SER SER B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 ASN 29 29 29 ASN ASN B . n B 1 30 GLU 30 30 30 GLU GLU B . n B 1 31 GLN 31 31 31 GLN GLN B . n B 1 32 LEU 32 32 32 LEU LEU B . n B 1 33 CYS 33 33 33 CYS CYS B . n B 1 34 TYR 34 34 34 TYR TYR B . n B 1 35 VAL 35 35 35 VAL VAL B . n B 1 36 ASP 36 36 36 ASP ASP B . n B 1 37 LEU 37 37 37 LEU LEU B . n B 1 38 GLY 38 38 38 GLY GLY B . n B 1 39 ASN 39 39 39 ASN ASN B . n B 1 40 GLU 40 40 40 GLU GLU B . n B 1 41 HIS 41 41 41 HIS HIS B . n B 1 42 PRO 42 42 42 PRO PRO B . n B 1 43 VAL 43 43 43 VAL VAL B . n B 1 44 LEU 44 44 44 LEU LEU B . n B 1 45 VAL 45 45 45 VAL VAL B . n B 1 46 LYS 46 46 46 LYS LYS B . n B 1 47 ILE 47 47 47 ILE ILE B . n B 1 48 THR 48 48 48 THR THR B . n B 1 49 LEU 49 49 49 LEU LEU B . n B 1 50 ASP 50 50 50 ASP ASP B . n B 1 51 GLU 51 51 51 GLU GLU B . n B 1 52 GLY 52 52 52 GLY GLY B . n B 1 53 GLN 53 53 53 GLN GLN B . n B 1 54 PRO 54 54 54 PRO PRO B . n B 1 55 ALA 55 55 55 ALA ALA B . n B 1 56 TYR 56 56 56 TYR TYR B . n B 1 57 ALA 57 57 57 ALA ALA B . n B 1 58 PRO 58 58 58 PRO PRO B . n B 1 59 GLY 59 59 59 GLY GLY B . n B 1 60 LEU 60 60 60 LEU LEU B . n B 1 61 TYR 61 61 61 TYR TYR B . n B 1 62 THR 62 62 62 THR THR B . n B 1 63 VAL 63 63 63 VAL VAL B . n B 1 64 HIS 64 64 64 HIS HIS B . n B 1 65 LEU 65 65 65 LEU LEU B . n B 1 66 SER 66 66 66 SER SER B . n B 1 67 SER 67 67 67 SER SER B . n B 1 68 PHE 68 68 68 PHE PHE B . n B 1 69 LYS 69 69 69 LYS LYS B . n B 1 70 VAL 70 70 70 VAL VAL B . n B 1 71 GLY 71 71 71 GLY GLY B . n B 1 72 GLN 72 72 72 GLN GLN B . n B 1 73 PHE 73 73 73 PHE PHE B . n B 1 74 GLY 74 74 74 GLY GLY B . n B 1 75 SER 75 75 75 SER SER B . n B 1 76 LEU 76 76 76 LEU LEU B . n B 1 77 MET 77 77 77 MET MET B . n B 1 78 ILE 78 78 78 ILE ILE B . n B 1 79 ASP 79 79 79 ASP ASP B . n B 1 80 ARG 80 80 80 ARG ARG B . n B 1 81 LEU 81 81 81 LEU LEU B . n B 1 82 ARG 82 82 82 ARG ARG B . n B 1 83 LEU 83 83 83 LEU LEU B . n B 1 84 VAL 84 84 84 VAL VAL B . n B 1 85 PRO 85 85 85 PRO PRO B . n B 1 86 ALA 86 86 86 ALA ALA B . n B 1 87 LYS 87 87 87 LYS LYS B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-10-15 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H B THR 62 ? ? O B VAL 84 ? ? 1.45 2 1 H A THR 62 ? ? O A VAL 84 ? ? 1.45 3 1 O A ASP 36 ? ? H A ASN 39 ? ? 1.54 4 1 O B ASP 36 ? ? H B ASN 39 ? ? 1.54 5 1 H A GLY 18 ? ? O A TYR 26 ? ? 1.57 6 1 H B GLY 18 ? ? O B TYR 26 ? ? 1.57 7 1 OE1 A GLN 31 ? ? H A LEU 32 ? ? 1.59 8 1 OE1 B GLN 31 ? ? H B LEU 32 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 4 ? ? 172.24 149.70 2 1 LYS A 7 ? ? -44.15 170.01 3 1 SER A 17 ? ? -54.38 106.98 4 1 SER A 20 ? ? -46.91 -78.81 5 1 ARG A 21 ? ? -148.62 53.25 6 1 LEU A 37 ? ? 48.98 21.40 7 1 GLU A 40 ? ? 70.68 -52.31 8 1 TYR A 56 ? ? -47.65 99.34 9 1 ALA A 57 ? ? -47.37 171.79 10 1 MET A 77 ? ? -160.29 117.49 11 1 ARG A 80 ? ? 174.47 68.95 12 1 LEU A 81 ? ? -31.48 121.35 13 1 VAL B 4 ? ? 172.27 149.74 14 1 LYS B 7 ? ? -44.14 170.03 15 1 SER B 17 ? ? -54.43 107.02 16 1 SER B 20 ? ? -46.91 -78.85 17 1 ARG B 21 ? ? -148.56 53.17 18 1 LEU B 37 ? ? 49.09 21.35 19 1 GLU B 40 ? ? 70.61 -52.36 20 1 TYR B 56 ? ? -47.58 98.08 21 1 ALA B 57 ? ? -46.20 171.75 22 1 MET B 77 ? ? -160.27 117.60 23 1 ARG B 80 ? ? 174.39 69.07 24 1 LEU B 81 ? ? -31.55 121.31 #