data_2GZR # _entry.id 2GZR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2GZR pdb_00002gzr 10.2210/pdb2gzr/pdb RCSB RCSB037749 ? ? WWPDB D_1000037749 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2GZS _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2GZR _pdbx_database_status.recvd_initial_deposition_date 2006-05-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Larsen, N.A.' 1 'Walsh, C.T.' 2 # _citation.id primary _citation.title 'Structural Characterization of Enterobactin Hydrolase IroE.' _citation.journal_abbrev Biochemistry _citation.journal_volume 45 _citation.page_first 10184 _citation.page_last 10190 _citation.year 2006 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16922493 _citation.pdbx_database_id_DOI 10.1021/bi060950i # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Larsen, N.A.' 1 ? primary 'Lin, H.' 2 ? primary 'Wei, R.' 3 ? primary 'Fischbach, M.A.' 4 ? primary 'Walsh, C.T.' 5 ? # _cell.entry_id 2GZR _cell.length_a 36.220 _cell.length_b 36.980 _cell.length_c 44.208 _cell.angle_alpha 111.469 _cell.angle_beta 89.691 _cell.angle_gamma 102.991 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2GZR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'IroE protein' _entity.formula_weight 31014.004 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;PNIADKGSVFYHFSATSFDSVDGTRHYRVWTAVPNTTAPASGYPILY(MSE)LDGNAV(MSE)DRLDDELLKQLSEKTPP VIVAVGYQTNLPFDLNSRAYDYTPAAESRKTDLHSGRFSRKSGGSNNFRQLLETRIAPKVEQGLNIDRQRRGLWGHSYGG LFVLDSWLSSSYFRSYYSASPSLGRGYDALLSRVTAVEPLQFCTKHLAI(MSE)EGSATQGDNRETHAVGVLSKIHTTLT ILKDKGVNAVFWDFPNLGHGP(MSE)FNASFRQALLDISGENANYTAGCHELSH ; _entity_poly.pdbx_seq_one_letter_code_can ;PNIADKGSVFYHFSATSFDSVDGTRHYRVWTAVPNTTAPASGYPILYMLDGNAVMDRLDDELLKQLSEKTPPVIVAVGYQ TNLPFDLNSRAYDYTPAAESRKTDLHSGRFSRKSGGSNNFRQLLETRIAPKVEQGLNIDRQRRGLWGHSYGGLFVLDSWL SSSYFRSYYSASPSLGRGYDALLSRVTAVEPLQFCTKHLAIMEGSATQGDNRETHAVGVLSKIHTTLTILKDKGVNAVFW DFPNLGHGPMFNASFRQALLDISGENANYTAGCHELSH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 ASN n 1 3 ILE n 1 4 ALA n 1 5 ASP n 1 6 LYS n 1 7 GLY n 1 8 SER n 1 9 VAL n 1 10 PHE n 1 11 TYR n 1 12 HIS n 1 13 PHE n 1 14 SER n 1 15 ALA n 1 16 THR n 1 17 SER n 1 18 PHE n 1 19 ASP n 1 20 SER n 1 21 VAL n 1 22 ASP n 1 23 GLY n 1 24 THR n 1 25 ARG n 1 26 HIS n 1 27 TYR n 1 28 ARG n 1 29 VAL n 1 30 TRP n 1 31 THR n 1 32 ALA n 1 33 VAL n 1 34 PRO n 1 35 ASN n 1 36 THR n 1 37 THR n 1 38 ALA n 1 39 PRO n 1 40 ALA n 1 41 SER n 1 42 GLY n 1 43 TYR n 1 44 PRO n 1 45 ILE n 1 46 LEU n 1 47 TYR n 1 48 MSE n 1 49 LEU n 1 50 ASP n 1 51 GLY n 1 52 ASN n 1 53 ALA n 1 54 VAL n 1 55 MSE n 1 56 ASP n 1 57 ARG n 1 58 LEU n 1 59 ASP n 1 60 ASP n 1 61 GLU n 1 62 LEU n 1 63 LEU n 1 64 LYS n 1 65 GLN n 1 66 LEU n 1 67 SER n 1 68 GLU n 1 69 LYS n 1 70 THR n 1 71 PRO n 1 72 PRO n 1 73 VAL n 1 74 ILE n 1 75 VAL n 1 76 ALA n 1 77 VAL n 1 78 GLY n 1 79 TYR n 1 80 GLN n 1 81 THR n 1 82 ASN n 1 83 LEU n 1 84 PRO n 1 85 PHE n 1 86 ASP n 1 87 LEU n 1 88 ASN n 1 89 SER n 1 90 ARG n 1 91 ALA n 1 92 TYR n 1 93 ASP n 1 94 TYR n 1 95 THR n 1 96 PRO n 1 97 ALA n 1 98 ALA n 1 99 GLU n 1 100 SER n 1 101 ARG n 1 102 LYS n 1 103 THR n 1 104 ASP n 1 105 LEU n 1 106 HIS n 1 107 SER n 1 108 GLY n 1 109 ARG n 1 110 PHE n 1 111 SER n 1 112 ARG n 1 113 LYS n 1 114 SER n 1 115 GLY n 1 116 GLY n 1 117 SER n 1 118 ASN n 1 119 ASN n 1 120 PHE n 1 121 ARG n 1 122 GLN n 1 123 LEU n 1 124 LEU n 1 125 GLU n 1 126 THR n 1 127 ARG n 1 128 ILE n 1 129 ALA n 1 130 PRO n 1 131 LYS n 1 132 VAL n 1 133 GLU n 1 134 GLN n 1 135 GLY n 1 136 LEU n 1 137 ASN n 1 138 ILE n 1 139 ASP n 1 140 ARG n 1 141 GLN n 1 142 ARG n 1 143 ARG n 1 144 GLY n 1 145 LEU n 1 146 TRP n 1 147 GLY n 1 148 HIS n 1 149 SER n 1 150 TYR n 1 151 GLY n 1 152 GLY n 1 153 LEU n 1 154 PHE n 1 155 VAL n 1 156 LEU n 1 157 ASP n 1 158 SER n 1 159 TRP n 1 160 LEU n 1 161 SER n 1 162 SER n 1 163 SER n 1 164 TYR n 1 165 PHE n 1 166 ARG n 1 167 SER n 1 168 TYR n 1 169 TYR n 1 170 SER n 1 171 ALA n 1 172 SER n 1 173 PRO n 1 174 SER n 1 175 LEU n 1 176 GLY n 1 177 ARG n 1 178 GLY n 1 179 TYR n 1 180 ASP n 1 181 ALA n 1 182 LEU n 1 183 LEU n 1 184 SER n 1 185 ARG n 1 186 VAL n 1 187 THR n 1 188 ALA n 1 189 VAL n 1 190 GLU n 1 191 PRO n 1 192 LEU n 1 193 GLN n 1 194 PHE n 1 195 CYS n 1 196 THR n 1 197 LYS n 1 198 HIS n 1 199 LEU n 1 200 ALA n 1 201 ILE n 1 202 MSE n 1 203 GLU n 1 204 GLY n 1 205 SER n 1 206 ALA n 1 207 THR n 1 208 GLN n 1 209 GLY n 1 210 ASP n 1 211 ASN n 1 212 ARG n 1 213 GLU n 1 214 THR n 1 215 HIS n 1 216 ALA n 1 217 VAL n 1 218 GLY n 1 219 VAL n 1 220 LEU n 1 221 SER n 1 222 LYS n 1 223 ILE n 1 224 HIS n 1 225 THR n 1 226 THR n 1 227 LEU n 1 228 THR n 1 229 ILE n 1 230 LEU n 1 231 LYS n 1 232 ASP n 1 233 LYS n 1 234 GLY n 1 235 VAL n 1 236 ASN n 1 237 ALA n 1 238 VAL n 1 239 PHE n 1 240 TRP n 1 241 ASP n 1 242 PHE n 1 243 PRO n 1 244 ASN n 1 245 LEU n 1 246 GLY n 1 247 HIS n 1 248 GLY n 1 249 PRO n 1 250 MSE n 1 251 PHE n 1 252 ASN n 1 253 ALA n 1 254 SER n 1 255 PHE n 1 256 ARG n 1 257 GLN n 1 258 ALA n 1 259 LEU n 1 260 LEU n 1 261 ASP n 1 262 ILE n 1 263 SER n 1 264 GLY n 1 265 GLU n 1 266 ASN n 1 267 ALA n 1 268 ASN n 1 269 TYR n 1 270 THR n 1 271 ALA n 1 272 GLY n 1 273 CYS n 1 274 HIS n 1 275 GLU n 1 276 LEU n 1 277 SER n 1 278 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene iroE _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6KD95_ECOLI _struct_ref.pdbx_db_accession Q6KD95 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 41 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2GZR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 278 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6KD95 _struct_ref_seq.db_align_beg 41 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 318 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 41 _struct_ref_seq.pdbx_auth_seq_align_end 318 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2GZR MSE A 48 ? UNP Q6KD95 MET 88 'modified residue' 88 1 1 2GZR MSE A 55 ? UNP Q6KD95 MET 95 'modified residue' 95 2 1 2GZR MSE A 202 ? UNP Q6KD95 MET 242 'modified residue' 242 3 1 2GZR MSE A 250 ? UNP Q6KD95 MET 290 'modified residue' 290 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2GZR _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.72 _exptl_crystal.density_percent_sol 28.66 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '6-10% PEG 3350, 100 mM Hepes, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 296K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 120 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2006-02-10 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97960 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 8.2.1' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 8.2.1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97960 # _reflns.entry_id 2GZR _reflns.observed_criterion_sigma_I 1 _reflns.observed_criterion_sigma_F 1 _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 2.3 _reflns.number_obs 18258 _reflns.number_all 17705 _reflns.percent_possible_obs 93.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.3 _reflns_shell.d_res_low 2.35 _reflns_shell.percent_possible_all 89.8 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2GZR _refine.ls_number_reflns_obs 16903 _refine.ls_number_reflns_all 18258 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 2.3 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.203 _refine.ls_R_factor_R_free 0.268 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 815 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 2GZS _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details Random _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1895 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1895 _refine_hist.d_res_high 2.3 _refine_hist.d_res_low 20.0 # _struct.entry_id 2GZR _struct.title 'Enterobactin and Salmochelin Hydrolase IroE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2GZR _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'serine hydrolase, catalytic dyad, enterobactin, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 1 ? GLY A 7 ? PRO A 41 GLY A 47 1 ? 7 HELX_P HELX_P2 2 ASP A 50 ? LEU A 58 ? ASP A 90 LEU A 98 1 ? 9 HELX_P HELX_P3 3 ASP A 59 ? GLU A 68 ? ASP A 99 GLU A 108 1 ? 10 HELX_P HELX_P4 4 ASP A 86 ? TYR A 94 ? ASP A 126 TYR A 134 1 ? 9 HELX_P HELX_P5 5 GLY A 116 ? ARG A 127 ? GLY A 156 ARG A 167 1 ? 12 HELX_P HELX_P6 6 ARG A 127 ? GLU A 133 ? ARG A 167 GLU A 173 1 ? 7 HELX_P HELX_P7 7 SER A 149 ? SER A 162 ? SER A 189 SER A 202 1 ? 14 HELX_P HELX_P8 8 TYR A 179 ? ALA A 188 ? TYR A 219 ALA A 228 1 ? 10 HELX_P HELX_P9 9 PRO A 191 ? CYS A 195 ? PRO A 231 CYS A 235 5 ? 5 HELX_P HELX_P10 10 GLY A 218 ? LYS A 233 ? GLY A 258 LYS A 273 1 ? 16 HELX_P HELX_P11 11 GLY A 246 ? SER A 263 ? GLY A 286 SER A 303 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A TYR 47 C ? ? ? 1_555 A MSE 48 N ? ? A TYR 87 A MSE 88 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale2 covale both ? A MSE 48 C ? ? ? 1_555 A LEU 49 N ? ? A MSE 88 A LEU 89 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale3 covale both ? A VAL 54 C ? ? ? 1_555 A MSE 55 N ? ? A VAL 94 A MSE 95 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale4 covale both ? A MSE 55 C ? ? ? 1_555 A ASP 56 N ? ? A MSE 95 A ASP 96 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale5 covale both ? A ILE 201 C ? ? ? 1_555 A MSE 202 N ? ? A ILE 241 A MSE 242 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale6 covale both ? A MSE 202 C ? ? ? 1_555 A GLU 203 N ? ? A MSE 242 A GLU 243 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale7 covale both ? A PRO 249 C ? ? ? 1_555 A MSE 250 N ? ? A PRO 289 A MSE 290 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale8 covale both ? A MSE 250 C ? ? ? 1_555 A PHE 251 N ? ? A MSE 290 A PHE 291 1_555 ? ? ? ? ? ? ? 1.337 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? parallel A 7 8 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 11 ? ASP A 19 ? TYR A 51 ASP A 59 A 2 HIS A 26 ? PRO A 34 ? HIS A 66 PRO A 74 A 3 VAL A 73 ? TYR A 79 ? VAL A 113 TYR A 119 A 4 TYR A 43 ? MSE A 48 ? TYR A 83 MSE A 88 A 5 ILE A 138 ? HIS A 148 ? ILE A 178 HIS A 188 A 6 SER A 167 ? ALA A 171 ? SER A 207 ALA A 211 A 7 HIS A 198 ? GLU A 203 ? HIS A 238 GLU A 243 A 8 ASN A 236 ? ASP A 241 ? ASN A 276 ASP A 281 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 18 ? N PHE A 58 O TYR A 27 ? O TYR A 67 A 2 3 N ALA A 32 ? N ALA A 72 O ILE A 74 ? O ILE A 114 A 3 4 O VAL A 75 ? O VAL A 115 N MSE A 48 ? N MSE A 88 A 4 5 N TYR A 47 ? N TYR A 87 O GLY A 144 ? O GLY A 184 A 5 6 N LEU A 145 ? N LEU A 185 O TYR A 169 ? O TYR A 209 A 6 7 N SER A 170 ? N SER A 210 O MSE A 202 ? O MSE A 242 A 7 8 N LEU A 199 ? N LEU A 239 O VAL A 238 ? O VAL A 278 # _database_PDB_matrix.entry_id 2GZR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2GZR _atom_sites.fract_transf_matrix[1][1] 0.027609 _atom_sites.fract_transf_matrix[1][2] 0.006369 _atom_sites.fract_transf_matrix[1][3] 0.002411 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027752 _atom_sites.fract_transf_matrix[2][3] 0.011204 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024395 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 41 41 PRO PRO A . n A 1 2 ASN 2 42 42 ASN ASN A . n A 1 3 ILE 3 43 43 ILE ILE A . n A 1 4 ALA 4 44 44 ALA ALA A . n A 1 5 ASP 5 45 45 ASP ASP A . n A 1 6 LYS 6 46 46 LYS LYS A . n A 1 7 GLY 7 47 47 GLY GLY A . n A 1 8 SER 8 48 48 SER SER A . n A 1 9 VAL 9 49 49 VAL VAL A . n A 1 10 PHE 10 50 50 PHE PHE A . n A 1 11 TYR 11 51 51 TYR TYR A . n A 1 12 HIS 12 52 52 HIS HIS A . n A 1 13 PHE 13 53 53 PHE PHE A . n A 1 14 SER 14 54 54 SER SER A . n A 1 15 ALA 15 55 55 ALA ALA A . n A 1 16 THR 16 56 56 THR THR A . n A 1 17 SER 17 57 57 SER SER A . n A 1 18 PHE 18 58 58 PHE PHE A . n A 1 19 ASP 19 59 59 ASP ASP A . n A 1 20 SER 20 60 60 SER SER A . n A 1 21 VAL 21 61 61 VAL VAL A . n A 1 22 ASP 22 62 62 ASP ASP A . n A 1 23 GLY 23 63 63 GLY GLY A . n A 1 24 THR 24 64 64 THR THR A . n A 1 25 ARG 25 65 65 ARG ARG A . n A 1 26 HIS 26 66 66 HIS HIS A . n A 1 27 TYR 27 67 67 TYR TYR A . n A 1 28 ARG 28 68 68 ARG ARG A . n A 1 29 VAL 29 69 69 VAL VAL A . n A 1 30 TRP 30 70 70 TRP TRP A . n A 1 31 THR 31 71 71 THR THR A . n A 1 32 ALA 32 72 72 ALA ALA A . n A 1 33 VAL 33 73 73 VAL VAL A . n A 1 34 PRO 34 74 74 PRO PRO A . n A 1 35 ASN 35 75 75 ASN ASN A . n A 1 36 THR 36 76 76 THR THR A . n A 1 37 THR 37 77 77 THR THR A . n A 1 38 ALA 38 78 78 ALA ALA A . n A 1 39 PRO 39 79 79 PRO PRO A . n A 1 40 ALA 40 80 80 ALA ALA A . n A 1 41 SER 41 81 81 SER SER A . n A 1 42 GLY 42 82 82 GLY GLY A . n A 1 43 TYR 43 83 83 TYR TYR A . n A 1 44 PRO 44 84 84 PRO PRO A . n A 1 45 ILE 45 85 85 ILE ILE A . n A 1 46 LEU 46 86 86 LEU LEU A . n A 1 47 TYR 47 87 87 TYR TYR A . n A 1 48 MSE 48 88 88 MSE MSE A . n A 1 49 LEU 49 89 89 LEU LEU A . n A 1 50 ASP 50 90 90 ASP ASP A . n A 1 51 GLY 51 91 91 GLY GLY A . n A 1 52 ASN 52 92 92 ASN ASN A . n A 1 53 ALA 53 93 93 ALA ALA A . n A 1 54 VAL 54 94 94 VAL VAL A . n A 1 55 MSE 55 95 95 MSE MSE A . n A 1 56 ASP 56 96 96 ASP ASP A . n A 1 57 ARG 57 97 97 ARG ARG A . n A 1 58 LEU 58 98 98 LEU LEU A . n A 1 59 ASP 59 99 99 ASP ASP A . n A 1 60 ASP 60 100 100 ASP ASP A . n A 1 61 GLU 61 101 101 GLU GLU A . n A 1 62 LEU 62 102 102 LEU LEU A . n A 1 63 LEU 63 103 103 LEU LEU A . n A 1 64 LYS 64 104 104 LYS LYS A . n A 1 65 GLN 65 105 105 GLN GLN A . n A 1 66 LEU 66 106 106 LEU LEU A . n A 1 67 SER 67 107 107 SER SER A . n A 1 68 GLU 68 108 108 GLU GLU A . n A 1 69 LYS 69 109 109 LYS LYS A . n A 1 70 THR 70 110 110 THR THR A . n A 1 71 PRO 71 111 111 PRO PRO A . n A 1 72 PRO 72 112 112 PRO PRO A . n A 1 73 VAL 73 113 113 VAL VAL A . n A 1 74 ILE 74 114 114 ILE ILE A . n A 1 75 VAL 75 115 115 VAL VAL A . n A 1 76 ALA 76 116 116 ALA ALA A . n A 1 77 VAL 77 117 117 VAL VAL A . n A 1 78 GLY 78 118 118 GLY GLY A . n A 1 79 TYR 79 119 119 TYR TYR A . n A 1 80 GLN 80 120 120 GLN GLN A . n A 1 81 THR 81 121 121 THR THR A . n A 1 82 ASN 82 122 122 ASN ASN A . n A 1 83 LEU 83 123 123 LEU LEU A . n A 1 84 PRO 84 124 124 PRO PRO A . n A 1 85 PHE 85 125 125 PHE PHE A . n A 1 86 ASP 86 126 126 ASP ASP A . n A 1 87 LEU 87 127 127 LEU LEU A . n A 1 88 ASN 88 128 128 ASN ASN A . n A 1 89 SER 89 129 129 SER SER A . n A 1 90 ARG 90 130 130 ARG ARG A . n A 1 91 ALA 91 131 131 ALA ALA A . n A 1 92 TYR 92 132 132 TYR TYR A . n A 1 93 ASP 93 133 133 ASP ASP A . n A 1 94 TYR 94 134 134 TYR TYR A . n A 1 95 THR 95 135 135 THR THR A . n A 1 96 PRO 96 136 136 PRO PRO A . n A 1 97 ALA 97 137 137 ALA ALA A . n A 1 98 ALA 98 138 138 ALA ALA A . n A 1 99 GLU 99 139 139 GLU GLU A . n A 1 100 SER 100 140 ? ? ? A . n A 1 101 ARG 101 141 ? ? ? A . n A 1 102 LYS 102 142 ? ? ? A . n A 1 103 THR 103 143 ? ? ? A . n A 1 104 ASP 104 144 ? ? ? A . n A 1 105 LEU 105 145 ? ? ? A . n A 1 106 HIS 106 146 ? ? ? A . n A 1 107 SER 107 147 ? ? ? A . n A 1 108 GLY 108 148 ? ? ? A . n A 1 109 ARG 109 149 ? ? ? A . n A 1 110 PHE 110 150 ? ? ? A . n A 1 111 SER 111 151 ? ? ? A . n A 1 112 ARG 112 152 152 ARG ARG A . n A 1 113 LYS 113 153 153 LYS LYS A . n A 1 114 SER 114 154 154 SER SER A . n A 1 115 GLY 115 155 155 GLY GLY A . n A 1 116 GLY 116 156 156 GLY GLY A . n A 1 117 SER 117 157 157 SER SER A . n A 1 118 ASN 118 158 158 ASN ASN A . n A 1 119 ASN 119 159 159 ASN ASN A . n A 1 120 PHE 120 160 160 PHE PHE A . n A 1 121 ARG 121 161 161 ARG ARG A . n A 1 122 GLN 122 162 162 GLN GLN A . n A 1 123 LEU 123 163 163 LEU LEU A . n A 1 124 LEU 124 164 164 LEU LEU A . n A 1 125 GLU 125 165 165 GLU GLU A . n A 1 126 THR 126 166 166 THR THR A . n A 1 127 ARG 127 167 167 ARG ARG A . n A 1 128 ILE 128 168 168 ILE ILE A . n A 1 129 ALA 129 169 169 ALA ALA A . n A 1 130 PRO 130 170 170 PRO PRO A . n A 1 131 LYS 131 171 171 LYS LYS A . n A 1 132 VAL 132 172 172 VAL VAL A . n A 1 133 GLU 133 173 173 GLU GLU A . n A 1 134 GLN 134 174 174 GLN GLN A . n A 1 135 GLY 135 175 175 GLY GLY A . n A 1 136 LEU 136 176 176 LEU LEU A . n A 1 137 ASN 137 177 177 ASN ASN A . n A 1 138 ILE 138 178 178 ILE ILE A . n A 1 139 ASP 139 179 179 ASP ASP A . n A 1 140 ARG 140 180 180 ARG ARG A . n A 1 141 GLN 141 181 181 GLN GLN A . n A 1 142 ARG 142 182 182 ARG ARG A . n A 1 143 ARG 143 183 183 ARG ARG A . n A 1 144 GLY 144 184 184 GLY GLY A . n A 1 145 LEU 145 185 185 LEU LEU A . n A 1 146 TRP 146 186 186 TRP TRP A . n A 1 147 GLY 147 187 187 GLY GLY A . n A 1 148 HIS 148 188 188 HIS HIS A . n A 1 149 SER 149 189 189 SER SER A . n A 1 150 TYR 150 190 190 TYR TYR A . n A 1 151 GLY 151 191 191 GLY GLY A . n A 1 152 GLY 152 192 192 GLY GLY A . n A 1 153 LEU 153 193 193 LEU LEU A . n A 1 154 PHE 154 194 194 PHE PHE A . n A 1 155 VAL 155 195 195 VAL VAL A . n A 1 156 LEU 156 196 196 LEU LEU A . n A 1 157 ASP 157 197 197 ASP ASP A . n A 1 158 SER 158 198 198 SER SER A . n A 1 159 TRP 159 199 199 TRP TRP A . n A 1 160 LEU 160 200 200 LEU LEU A . n A 1 161 SER 161 201 201 SER SER A . n A 1 162 SER 162 202 202 SER SER A . n A 1 163 SER 163 203 203 SER SER A . n A 1 164 TYR 164 204 204 TYR TYR A . n A 1 165 PHE 165 205 205 PHE PHE A . n A 1 166 ARG 166 206 206 ARG ARG A . n A 1 167 SER 167 207 207 SER SER A . n A 1 168 TYR 168 208 208 TYR TYR A . n A 1 169 TYR 169 209 209 TYR TYR A . n A 1 170 SER 170 210 210 SER SER A . n A 1 171 ALA 171 211 211 ALA ALA A . n A 1 172 SER 172 212 212 SER SER A . n A 1 173 PRO 173 213 213 PRO PRO A . n A 1 174 SER 174 214 214 SER SER A . n A 1 175 LEU 175 215 215 LEU LEU A . n A 1 176 GLY 176 216 216 GLY GLY A . n A 1 177 ARG 177 217 217 ARG ARG A . n A 1 178 GLY 178 218 218 GLY GLY A . n A 1 179 TYR 179 219 219 TYR TYR A . n A 1 180 ASP 180 220 220 ASP ASP A . n A 1 181 ALA 181 221 221 ALA ALA A . n A 1 182 LEU 182 222 222 LEU LEU A . n A 1 183 LEU 183 223 223 LEU LEU A . n A 1 184 SER 184 224 224 SER SER A . n A 1 185 ARG 185 225 225 ARG ARG A . n A 1 186 VAL 186 226 226 VAL VAL A . n A 1 187 THR 187 227 227 THR THR A . n A 1 188 ALA 188 228 228 ALA ALA A . n A 1 189 VAL 189 229 229 VAL VAL A . n A 1 190 GLU 190 230 230 GLU GLU A . n A 1 191 PRO 191 231 231 PRO PRO A . n A 1 192 LEU 192 232 232 LEU LEU A . n A 1 193 GLN 193 233 233 GLN GLN A . n A 1 194 PHE 194 234 234 PHE PHE A . n A 1 195 CYS 195 235 235 CYS CYS A . n A 1 196 THR 196 236 236 THR THR A . n A 1 197 LYS 197 237 237 LYS LYS A . n A 1 198 HIS 198 238 238 HIS HIS A . n A 1 199 LEU 199 239 239 LEU LEU A . n A 1 200 ALA 200 240 240 ALA ALA A . n A 1 201 ILE 201 241 241 ILE ILE A . n A 1 202 MSE 202 242 242 MSE MSE A . n A 1 203 GLU 203 243 243 GLU GLU A . n A 1 204 GLY 204 244 244 GLY GLY A . n A 1 205 SER 205 245 245 SER SER A . n A 1 206 ALA 206 246 246 ALA ALA A . n A 1 207 THR 207 247 ? ? ? A . n A 1 208 GLN 208 248 ? ? ? A . n A 1 209 GLY 209 249 ? ? ? A . n A 1 210 ASP 210 250 ? ? ? A . n A 1 211 ASN 211 251 ? ? ? A . n A 1 212 ARG 212 252 ? ? ? A . n A 1 213 GLU 213 253 ? ? ? A . n A 1 214 THR 214 254 ? ? ? A . n A 1 215 HIS 215 255 ? ? ? A . n A 1 216 ALA 216 256 ? ? ? A . n A 1 217 VAL 217 257 ? ? ? A . n A 1 218 GLY 218 258 258 GLY GLY A . n A 1 219 VAL 219 259 259 VAL VAL A . n A 1 220 LEU 220 260 260 LEU LEU A . n A 1 221 SER 221 261 261 SER SER A . n A 1 222 LYS 222 262 262 LYS LYS A . n A 1 223 ILE 223 263 263 ILE ILE A . n A 1 224 HIS 224 264 264 HIS HIS A . n A 1 225 THR 225 265 265 THR THR A . n A 1 226 THR 226 266 266 THR THR A . n A 1 227 LEU 227 267 267 LEU LEU A . n A 1 228 THR 228 268 268 THR THR A . n A 1 229 ILE 229 269 269 ILE ILE A . n A 1 230 LEU 230 270 270 LEU LEU A . n A 1 231 LYS 231 271 271 LYS LYS A . n A 1 232 ASP 232 272 272 ASP ASP A . n A 1 233 LYS 233 273 273 LYS LYS A . n A 1 234 GLY 234 274 274 GLY GLY A . n A 1 235 VAL 235 275 275 VAL VAL A . n A 1 236 ASN 236 276 276 ASN ASN A . n A 1 237 ALA 237 277 277 ALA ALA A . n A 1 238 VAL 238 278 278 VAL VAL A . n A 1 239 PHE 239 279 279 PHE PHE A . n A 1 240 TRP 240 280 280 TRP TRP A . n A 1 241 ASP 241 281 281 ASP ASP A . n A 1 242 PHE 242 282 282 PHE PHE A . n A 1 243 PRO 243 283 283 PRO PRO A . n A 1 244 ASN 244 284 284 ASN ASN A . n A 1 245 LEU 245 285 285 LEU LEU A . n A 1 246 GLY 246 286 286 GLY GLY A . n A 1 247 HIS 247 287 287 HIS HIS A . n A 1 248 GLY 248 288 288 GLY GLY A . n A 1 249 PRO 249 289 289 PRO PRO A . n A 1 250 MSE 250 290 290 MSE MSE A . n A 1 251 PHE 251 291 291 PHE PHE A . n A 1 252 ASN 252 292 292 ASN ASN A . n A 1 253 ALA 253 293 293 ALA ALA A . n A 1 254 SER 254 294 294 SER SER A . n A 1 255 PHE 255 295 295 PHE PHE A . n A 1 256 ARG 256 296 296 ARG ARG A . n A 1 257 GLN 257 297 297 GLN GLN A . n A 1 258 ALA 258 298 298 ALA ALA A . n A 1 259 LEU 259 299 299 LEU LEU A . n A 1 260 LEU 260 300 300 LEU LEU A . n A 1 261 ASP 261 301 301 ASP ASP A . n A 1 262 ILE 262 302 302 ILE ILE A . n A 1 263 SER 263 303 303 SER SER A . n A 1 264 GLY 264 304 304 GLY GLY A . n A 1 265 GLU 265 305 305 GLU GLU A . n A 1 266 ASN 266 306 ? ? ? A . n A 1 267 ALA 267 307 ? ? ? A . n A 1 268 ASN 268 308 ? ? ? A . n A 1 269 TYR 269 309 ? ? ? A . n A 1 270 THR 270 310 ? ? ? A . n A 1 271 ALA 271 311 ? ? ? A . n A 1 272 GLY 272 312 ? ? ? A . n A 1 273 CYS 273 313 ? ? ? A . n A 1 274 HIS 274 314 ? ? ? A . n A 1 275 GLU 275 315 ? ? ? A . n A 1 276 LEU 276 316 ? ? ? A . n A 1 277 SER 277 317 ? ? ? A . n A 1 278 HIS 278 318 ? ? ? A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 48 A MSE 88 ? MET SELENOMETHIONINE 2 A MSE 55 A MSE 95 ? MET SELENOMETHIONINE 3 A MSE 202 A MSE 242 ? MET SELENOMETHIONINE 4 A MSE 250 A MSE 290 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-09-05 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-30 5 'Structure model' 1 4 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' 7 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_initial_refinement_model 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 5 'Structure model' '_chem_comp_atom.atom_id' 6 5 'Structure model' '_chem_comp_bond.atom_id_2' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CrystalClear 'data collection' . ? 1 HKL-2000 'data reduction' . ? 2 MOLREP phasing . ? 3 CNS refinement 1.1 ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 46 ? ? -53.17 -75.54 2 1 LYS A 109 ? ? -118.96 -125.20 3 1 ARG A 167 ? ? -128.31 -57.57 4 1 SER A 189 ? ? 63.65 -114.20 5 1 ARG A 217 ? ? -156.83 64.30 6 1 VAL A 229 ? ? -43.47 150.37 7 1 LEU A 232 ? ? -54.65 -76.95 8 1 SER A 245 ? ? 63.00 -49.56 9 1 ASN A 284 ? ? 58.80 11.93 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 140 ? A SER 100 2 1 Y 1 A ARG 141 ? A ARG 101 3 1 Y 1 A LYS 142 ? A LYS 102 4 1 Y 1 A THR 143 ? A THR 103 5 1 Y 1 A ASP 144 ? A ASP 104 6 1 Y 1 A LEU 145 ? A LEU 105 7 1 Y 1 A HIS 146 ? A HIS 106 8 1 Y 1 A SER 147 ? A SER 107 9 1 Y 1 A GLY 148 ? A GLY 108 10 1 Y 1 A ARG 149 ? A ARG 109 11 1 Y 1 A PHE 150 ? A PHE 110 12 1 Y 1 A SER 151 ? A SER 111 13 1 Y 1 A THR 247 ? A THR 207 14 1 Y 1 A GLN 248 ? A GLN 208 15 1 Y 1 A GLY 249 ? A GLY 209 16 1 Y 1 A ASP 250 ? A ASP 210 17 1 Y 1 A ASN 251 ? A ASN 211 18 1 Y 1 A ARG 252 ? A ARG 212 19 1 Y 1 A GLU 253 ? A GLU 213 20 1 Y 1 A THR 254 ? A THR 214 21 1 Y 1 A HIS 255 ? A HIS 215 22 1 Y 1 A ALA 256 ? A ALA 216 23 1 Y 1 A VAL 257 ? A VAL 217 24 1 Y 1 A ASN 306 ? A ASN 266 25 1 Y 1 A ALA 307 ? A ALA 267 26 1 Y 1 A ASN 308 ? A ASN 268 27 1 Y 1 A TYR 309 ? A TYR 269 28 1 Y 1 A THR 310 ? A THR 270 29 1 Y 1 A ALA 311 ? A ALA 271 30 1 Y 1 A GLY 312 ? A GLY 272 31 1 Y 1 A CYS 313 ? A CYS 273 32 1 Y 1 A HIS 314 ? A HIS 274 33 1 Y 1 A GLU 315 ? A GLU 275 34 1 Y 1 A LEU 316 ? A LEU 276 35 1 Y 1 A SER 317 ? A SER 277 36 1 Y 1 A HIS 318 ? A HIS 278 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 MSE N N N N 247 MSE CA C N S 248 MSE C C N N 249 MSE O O N N 250 MSE OXT O N N 251 MSE CB C N N 252 MSE CG C N N 253 MSE SE SE N N 254 MSE CE C N N 255 MSE H H N N 256 MSE H2 H N N 257 MSE HA H N N 258 MSE HXT H N N 259 MSE HB2 H N N 260 MSE HB3 H N N 261 MSE HG2 H N N 262 MSE HG3 H N N 263 MSE HE1 H N N 264 MSE HE2 H N N 265 MSE HE3 H N N 266 PHE N N N N 267 PHE CA C N S 268 PHE C C N N 269 PHE O O N N 270 PHE CB C N N 271 PHE CG C Y N 272 PHE CD1 C Y N 273 PHE CD2 C Y N 274 PHE CE1 C Y N 275 PHE CE2 C Y N 276 PHE CZ C Y N 277 PHE OXT O N N 278 PHE H H N N 279 PHE H2 H N N 280 PHE HA H N N 281 PHE HB2 H N N 282 PHE HB3 H N N 283 PHE HD1 H N N 284 PHE HD2 H N N 285 PHE HE1 H N N 286 PHE HE2 H N N 287 PHE HZ H N N 288 PHE HXT H N N 289 PRO N N N N 290 PRO CA C N S 291 PRO C C N N 292 PRO O O N N 293 PRO CB C N N 294 PRO CG C N N 295 PRO CD C N N 296 PRO OXT O N N 297 PRO H H N N 298 PRO HA H N N 299 PRO HB2 H N N 300 PRO HB3 H N N 301 PRO HG2 H N N 302 PRO HG3 H N N 303 PRO HD2 H N N 304 PRO HD3 H N N 305 PRO HXT H N N 306 SER N N N N 307 SER CA C N S 308 SER C C N N 309 SER O O N N 310 SER CB C N N 311 SER OG O N N 312 SER OXT O N N 313 SER H H N N 314 SER H2 H N N 315 SER HA H N N 316 SER HB2 H N N 317 SER HB3 H N N 318 SER HG H N N 319 SER HXT H N N 320 THR N N N N 321 THR CA C N S 322 THR C C N N 323 THR O O N N 324 THR CB C N R 325 THR OG1 O N N 326 THR CG2 C N N 327 THR OXT O N N 328 THR H H N N 329 THR H2 H N N 330 THR HA H N N 331 THR HB H N N 332 THR HG1 H N N 333 THR HG21 H N N 334 THR HG22 H N N 335 THR HG23 H N N 336 THR HXT H N N 337 TRP N N N N 338 TRP CA C N S 339 TRP C C N N 340 TRP O O N N 341 TRP CB C N N 342 TRP CG C Y N 343 TRP CD1 C Y N 344 TRP CD2 C Y N 345 TRP NE1 N Y N 346 TRP CE2 C Y N 347 TRP CE3 C Y N 348 TRP CZ2 C Y N 349 TRP CZ3 C Y N 350 TRP CH2 C Y N 351 TRP OXT O N N 352 TRP H H N N 353 TRP H2 H N N 354 TRP HA H N N 355 TRP HB2 H N N 356 TRP HB3 H N N 357 TRP HD1 H N N 358 TRP HE1 H N N 359 TRP HE3 H N N 360 TRP HZ2 H N N 361 TRP HZ3 H N N 362 TRP HH2 H N N 363 TRP HXT H N N 364 TYR N N N N 365 TYR CA C N S 366 TYR C C N N 367 TYR O O N N 368 TYR CB C N N 369 TYR CG C Y N 370 TYR CD1 C Y N 371 TYR CD2 C Y N 372 TYR CE1 C Y N 373 TYR CE2 C Y N 374 TYR CZ C Y N 375 TYR OH O N N 376 TYR OXT O N N 377 TYR H H N N 378 TYR H2 H N N 379 TYR HA H N N 380 TYR HB2 H N N 381 TYR HB3 H N N 382 TYR HD1 H N N 383 TYR HD2 H N N 384 TYR HE1 H N N 385 TYR HE2 H N N 386 TYR HH H N N 387 TYR HXT H N N 388 VAL N N N N 389 VAL CA C N S 390 VAL C C N N 391 VAL O O N N 392 VAL CB C N N 393 VAL CG1 C N N 394 VAL CG2 C N N 395 VAL OXT O N N 396 VAL H H N N 397 VAL H2 H N N 398 VAL HA H N N 399 VAL HB H N N 400 VAL HG11 H N N 401 VAL HG12 H N N 402 VAL HG13 H N N 403 VAL HG21 H N N 404 VAL HG22 H N N 405 VAL HG23 H N N 406 VAL HXT H N N 407 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 MSE N CA sing N N 235 MSE N H sing N N 236 MSE N H2 sing N N 237 MSE CA C sing N N 238 MSE CA CB sing N N 239 MSE CA HA sing N N 240 MSE C O doub N N 241 MSE C OXT sing N N 242 MSE OXT HXT sing N N 243 MSE CB CG sing N N 244 MSE CB HB2 sing N N 245 MSE CB HB3 sing N N 246 MSE CG SE sing N N 247 MSE CG HG2 sing N N 248 MSE CG HG3 sing N N 249 MSE SE CE sing N N 250 MSE CE HE1 sing N N 251 MSE CE HE2 sing N N 252 MSE CE HE3 sing N N 253 PHE N CA sing N N 254 PHE N H sing N N 255 PHE N H2 sing N N 256 PHE CA C sing N N 257 PHE CA CB sing N N 258 PHE CA HA sing N N 259 PHE C O doub N N 260 PHE C OXT sing N N 261 PHE CB CG sing N N 262 PHE CB HB2 sing N N 263 PHE CB HB3 sing N N 264 PHE CG CD1 doub Y N 265 PHE CG CD2 sing Y N 266 PHE CD1 CE1 sing Y N 267 PHE CD1 HD1 sing N N 268 PHE CD2 CE2 doub Y N 269 PHE CD2 HD2 sing N N 270 PHE CE1 CZ doub Y N 271 PHE CE1 HE1 sing N N 272 PHE CE2 CZ sing Y N 273 PHE CE2 HE2 sing N N 274 PHE CZ HZ sing N N 275 PHE OXT HXT sing N N 276 PRO N CA sing N N 277 PRO N CD sing N N 278 PRO N H sing N N 279 PRO CA C sing N N 280 PRO CA CB sing N N 281 PRO CA HA sing N N 282 PRO C O doub N N 283 PRO C OXT sing N N 284 PRO CB CG sing N N 285 PRO CB HB2 sing N N 286 PRO CB HB3 sing N N 287 PRO CG CD sing N N 288 PRO CG HG2 sing N N 289 PRO CG HG3 sing N N 290 PRO CD HD2 sing N N 291 PRO CD HD3 sing N N 292 PRO OXT HXT sing N N 293 SER N CA sing N N 294 SER N H sing N N 295 SER N H2 sing N N 296 SER CA C sing N N 297 SER CA CB sing N N 298 SER CA HA sing N N 299 SER C O doub N N 300 SER C OXT sing N N 301 SER CB OG sing N N 302 SER CB HB2 sing N N 303 SER CB HB3 sing N N 304 SER OG HG sing N N 305 SER OXT HXT sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TRP N CA sing N N 323 TRP N H sing N N 324 TRP N H2 sing N N 325 TRP CA C sing N N 326 TRP CA CB sing N N 327 TRP CA HA sing N N 328 TRP C O doub N N 329 TRP C OXT sing N N 330 TRP CB CG sing N N 331 TRP CB HB2 sing N N 332 TRP CB HB3 sing N N 333 TRP CG CD1 doub Y N 334 TRP CG CD2 sing Y N 335 TRP CD1 NE1 sing Y N 336 TRP CD1 HD1 sing N N 337 TRP CD2 CE2 doub Y N 338 TRP CD2 CE3 sing Y N 339 TRP NE1 CE2 sing Y N 340 TRP NE1 HE1 sing N N 341 TRP CE2 CZ2 sing Y N 342 TRP CE3 CZ3 doub Y N 343 TRP CE3 HE3 sing N N 344 TRP CZ2 CH2 doub Y N 345 TRP CZ2 HZ2 sing N N 346 TRP CZ3 CH2 sing Y N 347 TRP CZ3 HZ3 sing N N 348 TRP CH2 HH2 sing N N 349 TRP OXT HXT sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2GZS _pdbx_initial_refinement_model.details ? #