data_2HZQ # _entry.id 2HZQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2HZQ pdb_00002hzq 10.2210/pdb2hzq/pdb RCSB RCSB038955 ? ? WWPDB D_1000038955 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2HZR _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2HZQ _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2006-08-09 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Eichinger, A.' 1 'Skerra, A.' 2 # _citation.id primary _citation.title 'Structural insight into the dual ligand specificity and mode of high density lipoprotein association of apolipoprotein d.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 282 _citation.page_first 31068 _citation.page_last 31075 _citation.year 2007 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17699160 _citation.pdbx_database_id_DOI 10.1074/jbc.M703552200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Eichinger, A.' 1 ? primary 'Nasreen, A.' 2 ? primary 'Kim, H.J.' 3 ? primary 'Skerra, A.' 4 ? # _cell.entry_id 2HZQ _cell.length_a 49.206 _cell.length_b 49.206 _cell.length_c 144.126 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2HZQ _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Apolipoprotein D' 19988.102 1 ? 'L23P, W99H, C116S, I118S, L120S, P133V, N134A' ? ? 2 non-polymer syn PROGESTERONE 314.462 1 ? ? ? ? 3 water nat water 18.015 234 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Apo-D, ApoD' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;FHLGKCPNPPVQENFDVNKYPGRWYEIEKIPTTFENGRCIQANYSL(MSE)ENGKIKVLNQELRADGTVNQIEGEATPVN LTEPAKLEVKFSWF(MSE)PSAPYHILATDYENYALVYSCTSISQSFHVDFAWILARNVALPPETVDSLKNILTSNNIDV KK(MSE)TVTDQVNCPKLSAHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;FHLGKCPNPPVQENFDVNKYPGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEP AKLEVKFSWFMPSAPYHILATDYENYALVYSCTSISQSFHVDFAWILARNVALPPETVDSLKNILTSNNIDVKKMTVTDQ VNCPKLSAHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PHE n 1 2 HIS n 1 3 LEU n 1 4 GLY n 1 5 LYS n 1 6 CYS n 1 7 PRO n 1 8 ASN n 1 9 PRO n 1 10 PRO n 1 11 VAL n 1 12 GLN n 1 13 GLU n 1 14 ASN n 1 15 PHE n 1 16 ASP n 1 17 VAL n 1 18 ASN n 1 19 LYS n 1 20 TYR n 1 21 PRO n 1 22 GLY n 1 23 ARG n 1 24 TRP n 1 25 TYR n 1 26 GLU n 1 27 ILE n 1 28 GLU n 1 29 LYS n 1 30 ILE n 1 31 PRO n 1 32 THR n 1 33 THR n 1 34 PHE n 1 35 GLU n 1 36 ASN n 1 37 GLY n 1 38 ARG n 1 39 CYS n 1 40 ILE n 1 41 GLN n 1 42 ALA n 1 43 ASN n 1 44 TYR n 1 45 SER n 1 46 LEU n 1 47 MSE n 1 48 GLU n 1 49 ASN n 1 50 GLY n 1 51 LYS n 1 52 ILE n 1 53 LYS n 1 54 VAL n 1 55 LEU n 1 56 ASN n 1 57 GLN n 1 58 GLU n 1 59 LEU n 1 60 ARG n 1 61 ALA n 1 62 ASP n 1 63 GLY n 1 64 THR n 1 65 VAL n 1 66 ASN n 1 67 GLN n 1 68 ILE n 1 69 GLU n 1 70 GLY n 1 71 GLU n 1 72 ALA n 1 73 THR n 1 74 PRO n 1 75 VAL n 1 76 ASN n 1 77 LEU n 1 78 THR n 1 79 GLU n 1 80 PRO n 1 81 ALA n 1 82 LYS n 1 83 LEU n 1 84 GLU n 1 85 VAL n 1 86 LYS n 1 87 PHE n 1 88 SER n 1 89 TRP n 1 90 PHE n 1 91 MSE n 1 92 PRO n 1 93 SER n 1 94 ALA n 1 95 PRO n 1 96 TYR n 1 97 HIS n 1 98 ILE n 1 99 LEU n 1 100 ALA n 1 101 THR n 1 102 ASP n 1 103 TYR n 1 104 GLU n 1 105 ASN n 1 106 TYR n 1 107 ALA n 1 108 LEU n 1 109 VAL n 1 110 TYR n 1 111 SER n 1 112 CYS n 1 113 THR n 1 114 SER n 1 115 ILE n 1 116 SER n 1 117 GLN n 1 118 SER n 1 119 PHE n 1 120 HIS n 1 121 VAL n 1 122 ASP n 1 123 PHE n 1 124 ALA n 1 125 TRP n 1 126 ILE n 1 127 LEU n 1 128 ALA n 1 129 ARG n 1 130 ASN n 1 131 VAL n 1 132 ALA n 1 133 LEU n 1 134 PRO n 1 135 PRO n 1 136 GLU n 1 137 THR n 1 138 VAL n 1 139 ASP n 1 140 SER n 1 141 LEU n 1 142 LYS n 1 143 ASN n 1 144 ILE n 1 145 LEU n 1 146 THR n 1 147 SER n 1 148 ASN n 1 149 ASN n 1 150 ILE n 1 151 ASP n 1 152 VAL n 1 153 LYS n 1 154 LYS n 1 155 MSE n 1 156 THR n 1 157 VAL n 1 158 THR n 1 159 ASP n 1 160 GLN n 1 161 VAL n 1 162 ASN n 1 163 CYS n 1 164 PRO n 1 165 LYS n 1 166 LEU n 1 167 SER n 1 168 ALA n 1 169 HIS n 1 170 HIS n 1 171 HIS n 1 172 HIS n 1 173 HIS n 1 174 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene APOD _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain KS272 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pApoD27delta(QA)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code APOD_HUMAN _struct_ref.pdbx_db_accession P05090 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;FHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEP AKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQ VNCPKLS ; _struct_ref.pdbx_align_begin 23 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2HZQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 167 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P05090 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 189 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 169 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2HZQ PRO A 21 ? UNP P05090 LEU 43 'engineered mutation' 23 1 1 2HZQ MSE A 47 ? UNP P05090 MET 69 'modified residue' 49 2 1 2HZQ MSE A 91 ? UNP P05090 MET 113 'modified residue' 93 3 1 2HZQ HIS A 97 ? UNP P05090 TRP 119 'engineered mutation' 99 4 1 2HZQ SER A 114 ? UNP P05090 CYS 136 'engineered mutation' 116 5 1 2HZQ SER A 116 ? UNP P05090 ILE 138 'engineered mutation' 118 6 1 2HZQ SER A 118 ? UNP P05090 LEU 140 'engineered mutation' 120 7 1 2HZQ VAL A 131 ? UNP P05090 PRO 153 'engineered mutation' 133 8 1 2HZQ ALA A 132 ? UNP P05090 ASN 154 'engineered mutation' 134 9 1 2HZQ MSE A 155 ? UNP P05090 MET 177 'modified residue' 157 10 1 2HZQ ALA A 168 ? UNP P05090 ? ? 'expression tag' 170 11 1 2HZQ HIS A 169 ? UNP P05090 ? ? 'expression tag' 171 12 1 2HZQ HIS A 170 ? UNP P05090 ? ? 'expression tag' 172 13 1 2HZQ HIS A 171 ? UNP P05090 ? ? 'expression tag' 173 14 1 2HZQ HIS A 172 ? UNP P05090 ? ? 'expression tag' 174 15 1 2HZQ HIS A 173 ? UNP P05090 ? ? 'expression tag' 175 16 1 2HZQ HIS A 174 ? UNP P05090 ? ? 'expression tag' 176 17 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 STR non-polymer . PROGESTERONE ? 'C21 H30 O2' 314.462 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 2HZQ _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.16 _exptl_crystal.density_percent_sol 43.7 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.pdbx_details '1.1 M lithium sulfate, 0.1 M ammonium formate, 0.075 M Hepes/NaOH, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2006-03-13 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00890 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.pdbx_wavelength_list 1.00890 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID23-1 # _reflns.entry_id 2HZQ _reflns.d_resolution_high 1.800 _reflns.d_resolution_low 46.575 _reflns.number_obs 17084 _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_netI_over_sigmaI 6.600 _reflns.pdbx_Rsym_value 0.07 _reflns.pdbx_redundancy 11.300 _reflns.percent_possible_obs 98.700 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 3.000 _reflns.number_all 17254 _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal 1.80 1.90 ? 26431 ? 0.308 2.3 0.308 ? 11.20 ? 2350 95.30 ? 1 1.90 2.01 ? 24905 ? 0.215 3.5 0.215 ? 11.10 ? 2236 97.50 ? 2 2.01 2.15 ? 23856 ? 0.136 5.3 0.136 ? 10.90 ? 2188 98.90 ? 3 2.15 2.32 ? 22574 ? 0.106 6.4 0.106 ? 11.00 ? 2053 99.20 ? 4 2.32 2.55 ? 21103 ? 0.093 7.4 0.093 ? 11.20 ? 1891 100.00 ? 5 2.55 2.85 ? 19866 ? 0.083 7.2 0.083 ? 11.50 ? 1730 100.00 ? 6 2.85 3.29 ? 17885 ? 0.064 9.2 0.064 ? 11.40 ? 1572 100.00 ? 7 3.29 4.02 ? 15037 ? 0.049 10.7 0.049 ? 11.30 ? 1332 100.00 ? 8 4.02 5.69 ? 14181 ? 0.046 11.8 0.046 ? 13.20 ? 1073 100.00 ? 9 5.69 49.21 ? 7562 ? 0.049 8.1 0.049 ? 11.50 ? 659 99.30 ? 10 # _refine.entry_id 2HZQ _refine.ls_d_res_high 1.800 _refine.ls_d_res_low 30.000 _refine.pdbx_ls_sigma_F 0.000 _refine.ls_percent_reflns_obs 98.650 _refine.ls_number_reflns_obs 17013 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.ls_R_factor_all 0.189 _refine.ls_R_factor_R_work 0.187 _refine.ls_R_factor_R_free 0.226 _refine.ls_percent_reflns_R_free 5.100 _refine.ls_number_reflns_R_free 860 _refine.B_iso_mean 22.551 _refine.aniso_B[1][1] 0.790 _refine.aniso_B[2][2] 0.790 _refine.aniso_B[3][3] -1.570 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.953 _refine.correlation_coeff_Fo_to_Fc_free 0.944 _refine.pdbx_overall_ESU_R 0.137 _refine.pdbx_overall_ESU_R_Free 0.130 _refine.overall_SU_ML 0.085 _refine.overall_SU_B 2.714 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 17254 _refine.ls_R_factor_obs 0.189 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model 'Model of uncomplexed ApoD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1327 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.number_atoms_solvent 235 _refine_hist.number_atoms_total 1585 _refine_hist.d_res_high 1.800 _refine_hist.d_res_low 30.000 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 1379 0.014 0.022 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1888 1.691 1.961 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 163 7.526 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 63 40.310 25.556 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 224 14.280 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 4 22.649 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 212 0.104 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 1045 0.006 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 590 0.210 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 951 0.312 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 176 0.135 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 43 0.193 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 12 0.215 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 857 1.107 1.500 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1358 1.738 2.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 600 2.794 3.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 530 4.265 4.500 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 1.800 _refine_ls_shell.d_res_low 1.847 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 94.400 _refine_ls_shell.number_reflns_R_work 1074 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.211 _refine_ls_shell.R_factor_R_free 0.314 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 89 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 1163 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2HZQ _struct.title 'Crystal structure of human apolipoprotein D (ApoD) in complex with progesterone' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2HZQ _struct_keywords.text 'lipocalin, beta barrel, bilin-binding protein, transport protein' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 16 ? TYR A 20 ? ASP A 18 TYR A 22 5 ? 5 HELX_P HELX_P2 2 PRO A 134 ? ASN A 148 ? PRO A 136 ASN A 150 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 112 SG ? ? A CYS 8 A CYS 114 1_555 ? ? ? ? ? ? ? 2.054 ? ? disulf2 disulf ? ? A CYS 39 SG ? ? ? 1_555 A CYS 163 SG ? ? A CYS 41 A CYS 165 1_555 ? ? ? ? ? ? ? 1.985 ? ? covale1 covale both ? A LEU 46 C ? ? ? 1_555 A MSE 47 N ? ? A LEU 48 A MSE 49 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale both ? A MSE 47 C ? ? ? 1_555 A GLU 48 N ? ? A MSE 49 A GLU 50 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale3 covale both ? A PHE 90 C ? ? ? 1_555 A MSE 91 N ? ? A PHE 92 A MSE 93 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale4 covale both ? A MSE 91 C ? ? ? 1_555 A PRO 92 N ? ? A MSE 93 A PRO 94 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale5 covale both ? A LYS 154 C ? ? ? 1_555 A MSE 155 N ? ? A LYS 156 A MSE 157 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale6 covale both ? A MSE 155 C ? ? ? 1_555 A THR 156 N ? ? A MSE 157 A THR 158 1_555 ? ? ? ? ? ? ? 1.332 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 10 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel B 7 8 ? anti-parallel B 8 9 ? anti-parallel B 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 2 ? LEU A 3 ? HIS A 4 LEU A 5 A 2 PHE A 119 ? ALA A 128 ? PHE A 121 ALA A 130 A 3 GLY A 22 ? LYS A 29 ? GLY A 24 LYS A 31 A 4 THR A 156 ? VAL A 157 ? THR A 158 VAL A 159 B 1 HIS A 2 ? LEU A 3 ? HIS A 4 LEU A 5 B 2 PHE A 119 ? ALA A 128 ? PHE A 121 ALA A 130 B 3 TYR A 106 ? SER A 114 ? TYR A 108 SER A 116 B 4 ALA A 94 ? THR A 101 ? ALA A 96 THR A 103 B 5 LYS A 82 ? LYS A 86 ? LYS A 84 LYS A 88 B 6 VAL A 65 ? PRO A 74 ? VAL A 67 PRO A 76 B 7 ILE A 52 ? LEU A 59 ? ILE A 54 LEU A 61 B 8 ARG A 38 ? LEU A 46 ? ARG A 40 LEU A 48 B 9 GLY A 22 ? LYS A 29 ? GLY A 24 LYS A 31 B 10 THR A 156 ? VAL A 157 ? THR A 158 VAL A 159 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N HIS A 2 ? N HIS A 4 O HIS A 120 ? O HIS A 122 A 2 3 O ALA A 128 ? O ALA A 130 N TYR A 25 ? N TYR A 27 A 3 4 N LYS A 29 ? N LYS A 31 O THR A 156 ? O THR A 158 B 1 2 N HIS A 2 ? N HIS A 4 O HIS A 120 ? O HIS A 122 B 2 3 O LEU A 127 ? O LEU A 129 N ALA A 107 ? N ALA A 109 B 3 4 O LEU A 108 ? O LEU A 110 N ALA A 100 ? N ALA A 102 B 4 5 O TYR A 96 ? O TYR A 98 N LEU A 83 ? N LEU A 85 B 5 6 O GLU A 84 ? O GLU A 86 N THR A 73 ? N THR A 75 B 6 7 O ALA A 72 ? O ALA A 74 N ILE A 52 ? N ILE A 54 B 7 8 O LYS A 53 ? O LYS A 55 N SER A 45 ? N SER A 47 B 8 9 O TYR A 44 ? O TYR A 46 N GLY A 22 ? N GLY A 24 B 9 10 N LYS A 29 ? N LYS A 31 O THR A 156 ? O THR A 158 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id STR _struct_site.pdbx_auth_seq_id 300 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 8 _struct_site.details 'BINDING SITE FOR RESIDUE STR A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 THR A 32 ? THR A 34 . ? 1_555 ? 2 AC1 8 ALA A 42 ? ALA A 44 . ? 1_555 ? 3 AC1 8 TYR A 44 ? TYR A 46 . ? 1_555 ? 4 AC1 8 ASN A 56 ? ASN A 58 . ? 1_555 ? 5 AC1 8 PHE A 87 ? PHE A 89 . ? 1_555 ? 6 AC1 8 TYR A 96 ? TYR A 98 . ? 1_555 ? 7 AC1 8 LEU A 127 ? LEU A 129 . ? 1_555 ? 8 AC1 8 HOH C . ? HOH A 461 . ? 1_555 ? # _atom_sites.entry_id 2HZQ _atom_sites.fract_transf_matrix[1][1] 0.020323 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020323 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006938 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PHE 1 3 3 PHE PHE A . n A 1 2 HIS 2 4 4 HIS HIS A . n A 1 3 LEU 3 5 5 LEU LEU A . n A 1 4 GLY 4 6 6 GLY GLY A . n A 1 5 LYS 5 7 7 LYS LYS A . n A 1 6 CYS 6 8 8 CYS CYS A . n A 1 7 PRO 7 9 9 PRO PRO A . n A 1 8 ASN 8 10 10 ASN ASN A . n A 1 9 PRO 9 11 11 PRO PRO A . n A 1 10 PRO 10 12 12 PRO PRO A . n A 1 11 VAL 11 13 13 VAL VAL A . n A 1 12 GLN 12 14 14 GLN GLN A . n A 1 13 GLU 13 15 15 GLU GLU A . n A 1 14 ASN 14 16 16 ASN ASN A . n A 1 15 PHE 15 17 17 PHE PHE A . n A 1 16 ASP 16 18 18 ASP ASP A . n A 1 17 VAL 17 19 19 VAL VAL A . n A 1 18 ASN 18 20 20 ASN ASN A . n A 1 19 LYS 19 21 21 LYS LYS A . n A 1 20 TYR 20 22 22 TYR TYR A . n A 1 21 PRO 21 23 23 PRO PRO A . n A 1 22 GLY 22 24 24 GLY GLY A . n A 1 23 ARG 23 25 25 ARG ARG A . n A 1 24 TRP 24 26 26 TRP TRP A . n A 1 25 TYR 25 27 27 TYR TYR A . n A 1 26 GLU 26 28 28 GLU GLU A . n A 1 27 ILE 27 29 29 ILE ILE A . n A 1 28 GLU 28 30 30 GLU GLU A . n A 1 29 LYS 29 31 31 LYS LYS A . n A 1 30 ILE 30 32 32 ILE ILE A . n A 1 31 PRO 31 33 33 PRO PRO A . n A 1 32 THR 32 34 34 THR THR A . n A 1 33 THR 33 35 35 THR THR A . n A 1 34 PHE 34 36 36 PHE PHE A . n A 1 35 GLU 35 37 37 GLU GLU A . n A 1 36 ASN 36 38 38 ASN ASN A . n A 1 37 GLY 37 39 39 GLY GLY A . n A 1 38 ARG 38 40 40 ARG ARG A . n A 1 39 CYS 39 41 41 CYS CYS A . n A 1 40 ILE 40 42 42 ILE ILE A . n A 1 41 GLN 41 43 43 GLN GLN A . n A 1 42 ALA 42 44 44 ALA ALA A . n A 1 43 ASN 43 45 45 ASN ASN A . n A 1 44 TYR 44 46 46 TYR TYR A . n A 1 45 SER 45 47 47 SER SER A . n A 1 46 LEU 46 48 48 LEU LEU A . n A 1 47 MSE 47 49 49 MSE MSE A . n A 1 48 GLU 48 50 50 GLU GLU A . n A 1 49 ASN 49 51 51 ASN ASN A . n A 1 50 GLY 50 52 52 GLY GLY A . n A 1 51 LYS 51 53 53 LYS LYS A . n A 1 52 ILE 52 54 54 ILE ILE A . n A 1 53 LYS 53 55 55 LYS LYS A . n A 1 54 VAL 54 56 56 VAL VAL A . n A 1 55 LEU 55 57 57 LEU LEU A . n A 1 56 ASN 56 58 58 ASN ASN A . n A 1 57 GLN 57 59 59 GLN GLN A . n A 1 58 GLU 58 60 60 GLU GLU A . n A 1 59 LEU 59 61 61 LEU LEU A . n A 1 60 ARG 60 62 62 ARG ARG A . n A 1 61 ALA 61 63 63 ALA ALA A . n A 1 62 ASP 62 64 64 ASP ASP A . n A 1 63 GLY 63 65 65 GLY GLY A . n A 1 64 THR 64 66 66 THR THR A . n A 1 65 VAL 65 67 67 VAL VAL A . n A 1 66 ASN 66 68 68 ASN ASN A . n A 1 67 GLN 67 69 69 GLN GLN A . n A 1 68 ILE 68 70 70 ILE ILE A . n A 1 69 GLU 69 71 71 GLU GLU A . n A 1 70 GLY 70 72 72 GLY GLY A . n A 1 71 GLU 71 73 73 GLU GLU A . n A 1 72 ALA 72 74 74 ALA ALA A . n A 1 73 THR 73 75 75 THR THR A . n A 1 74 PRO 74 76 76 PRO PRO A . n A 1 75 VAL 75 77 77 VAL VAL A . n A 1 76 ASN 76 78 78 ASN ASN A . n A 1 77 LEU 77 79 79 LEU LEU A . n A 1 78 THR 78 80 80 THR THR A . n A 1 79 GLU 79 81 81 GLU GLU A . n A 1 80 PRO 80 82 82 PRO PRO A . n A 1 81 ALA 81 83 83 ALA ALA A . n A 1 82 LYS 82 84 84 LYS LYS A . n A 1 83 LEU 83 85 85 LEU LEU A . n A 1 84 GLU 84 86 86 GLU GLU A . n A 1 85 VAL 85 87 87 VAL VAL A . n A 1 86 LYS 86 88 88 LYS LYS A . n A 1 87 PHE 87 89 89 PHE PHE A . n A 1 88 SER 88 90 90 SER SER A . n A 1 89 TRP 89 91 91 TRP TRP A . n A 1 90 PHE 90 92 92 PHE PHE A . n A 1 91 MSE 91 93 93 MSE MSE A . n A 1 92 PRO 92 94 94 PRO PRO A . n A 1 93 SER 93 95 95 SER SER A . n A 1 94 ALA 94 96 96 ALA ALA A . n A 1 95 PRO 95 97 97 PRO PRO A . n A 1 96 TYR 96 98 98 TYR TYR A . n A 1 97 HIS 97 99 99 HIS HIS A . n A 1 98 ILE 98 100 100 ILE ILE A . n A 1 99 LEU 99 101 101 LEU LEU A . n A 1 100 ALA 100 102 102 ALA ALA A . n A 1 101 THR 101 103 103 THR THR A . n A 1 102 ASP 102 104 104 ASP ASP A . n A 1 103 TYR 103 105 105 TYR TYR A . n A 1 104 GLU 104 106 106 GLU GLU A . n A 1 105 ASN 105 107 107 ASN ASN A . n A 1 106 TYR 106 108 108 TYR TYR A . n A 1 107 ALA 107 109 109 ALA ALA A . n A 1 108 LEU 108 110 110 LEU LEU A . n A 1 109 VAL 109 111 111 VAL VAL A . n A 1 110 TYR 110 112 112 TYR TYR A . n A 1 111 SER 111 113 113 SER SER A . n A 1 112 CYS 112 114 114 CYS CYS A . n A 1 113 THR 113 115 115 THR THR A . n A 1 114 SER 114 116 116 SER SER A . n A 1 115 ILE 115 117 117 ILE ILE A . n A 1 116 SER 116 118 118 SER SER A . n A 1 117 GLN 117 119 119 GLN GLN A . n A 1 118 SER 118 120 120 SER SER A . n A 1 119 PHE 119 121 121 PHE PHE A . n A 1 120 HIS 120 122 122 HIS HIS A . n A 1 121 VAL 121 123 123 VAL VAL A . n A 1 122 ASP 122 124 124 ASP ASP A . n A 1 123 PHE 123 125 125 PHE PHE A . n A 1 124 ALA 124 126 126 ALA ALA A . n A 1 125 TRP 125 127 127 TRP TRP A . n A 1 126 ILE 126 128 128 ILE ILE A . n A 1 127 LEU 127 129 129 LEU LEU A . n A 1 128 ALA 128 130 130 ALA ALA A . n A 1 129 ARG 129 131 131 ARG ARG A . n A 1 130 ASN 130 132 132 ASN ASN A . n A 1 131 VAL 131 133 133 VAL VAL A . n A 1 132 ALA 132 134 134 ALA ALA A . n A 1 133 LEU 133 135 135 LEU LEU A . n A 1 134 PRO 134 136 136 PRO PRO A . n A 1 135 PRO 135 137 137 PRO PRO A . n A 1 136 GLU 136 138 138 GLU GLU A . n A 1 137 THR 137 139 139 THR THR A . n A 1 138 VAL 138 140 140 VAL VAL A . n A 1 139 ASP 139 141 141 ASP ASP A . n A 1 140 SER 140 142 142 SER SER A . n A 1 141 LEU 141 143 143 LEU LEU A . n A 1 142 LYS 142 144 144 LYS LYS A . n A 1 143 ASN 143 145 145 ASN ASN A . n A 1 144 ILE 144 146 146 ILE ILE A . n A 1 145 LEU 145 147 147 LEU LEU A . n A 1 146 THR 146 148 148 THR THR A . n A 1 147 SER 147 149 149 SER SER A . n A 1 148 ASN 148 150 150 ASN ASN A . n A 1 149 ASN 149 151 151 ASN ASN A . n A 1 150 ILE 150 152 152 ILE ILE A . n A 1 151 ASP 151 153 153 ASP ASP A . n A 1 152 VAL 152 154 154 VAL VAL A . n A 1 153 LYS 153 155 155 LYS LYS A . n A 1 154 LYS 154 156 156 LYS LYS A . n A 1 155 MSE 155 157 157 MSE MSE A . n A 1 156 THR 156 158 158 THR THR A . n A 1 157 VAL 157 159 159 VAL VAL A . n A 1 158 THR 158 160 160 THR THR A . n A 1 159 ASP 159 161 161 ASP ASP A . n A 1 160 GLN 160 162 162 GLN GLN A . n A 1 161 VAL 161 163 163 VAL VAL A . n A 1 162 ASN 162 164 164 ASN ASN A . n A 1 163 CYS 163 165 165 CYS CYS A . n A 1 164 PRO 164 166 166 PRO PRO A . n A 1 165 LYS 165 167 167 LYS LYS A . n A 1 166 LEU 166 168 168 LEU LEU A . n A 1 167 SER 167 169 ? ? ? A . n A 1 168 ALA 168 170 ? ? ? A . n A 1 169 HIS 169 171 ? ? ? A . n A 1 170 HIS 170 172 ? ? ? A . n A 1 171 HIS 171 173 ? ? ? A . n A 1 172 HIS 172 174 ? ? ? A . n A 1 173 HIS 173 175 ? ? ? A . n A 1 174 HIS 174 176 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 STR 1 300 300 STR STR A . C 3 HOH 1 301 1 HOH HOH A . C 3 HOH 2 302 2 HOH HOH A . C 3 HOH 3 303 3 HOH HOH A . C 3 HOH 4 304 4 HOH HOH A . C 3 HOH 5 305 5 HOH HOH A . C 3 HOH 6 306 6 HOH HOH A . C 3 HOH 7 307 7 HOH HOH A . C 3 HOH 8 308 8 HOH HOH A . C 3 HOH 9 309 9 HOH HOH A . C 3 HOH 10 310 10 HOH HOH A . C 3 HOH 11 311 11 HOH HOH A . C 3 HOH 12 312 12 HOH HOH A . C 3 HOH 13 313 13 HOH HOH A . C 3 HOH 14 314 14 HOH HOH A . C 3 HOH 15 315 15 HOH HOH A . C 3 HOH 16 316 16 HOH HOH A . C 3 HOH 17 317 17 HOH HOH A . C 3 HOH 18 318 18 HOH HOH A . C 3 HOH 19 319 19 HOH HOH A . C 3 HOH 20 320 20 HOH HOH A . C 3 HOH 21 321 21 HOH HOH A . C 3 HOH 22 322 22 HOH HOH A . C 3 HOH 23 323 23 HOH HOH A . C 3 HOH 24 324 24 HOH HOH A . C 3 HOH 25 325 25 HOH HOH A . C 3 HOH 26 326 26 HOH HOH A . C 3 HOH 27 327 27 HOH HOH A . C 3 HOH 28 328 28 HOH HOH A . C 3 HOH 29 329 29 HOH HOH A . C 3 HOH 30 330 30 HOH HOH A . C 3 HOH 31 331 31 HOH HOH A . C 3 HOH 32 332 32 HOH HOH A . C 3 HOH 33 333 33 HOH HOH A . C 3 HOH 34 334 34 HOH HOH A . C 3 HOH 35 335 35 HOH HOH A . C 3 HOH 36 336 36 HOH HOH A . C 3 HOH 37 337 37 HOH HOH A . C 3 HOH 38 338 38 HOH HOH A . C 3 HOH 39 339 39 HOH HOH A . C 3 HOH 40 340 40 HOH HOH A . C 3 HOH 41 341 41 HOH HOH A . C 3 HOH 42 342 42 HOH HOH A . C 3 HOH 43 343 43 HOH HOH A . C 3 HOH 44 344 44 HOH HOH A . C 3 HOH 45 345 45 HOH HOH A . C 3 HOH 46 346 46 HOH HOH A . C 3 HOH 47 347 47 HOH HOH A . C 3 HOH 48 348 48 HOH HOH A . C 3 HOH 49 349 49 HOH HOH A . C 3 HOH 50 350 50 HOH HOH A . C 3 HOH 51 351 51 HOH HOH A . C 3 HOH 52 352 52 HOH HOH A . C 3 HOH 53 353 53 HOH HOH A . C 3 HOH 54 354 54 HOH HOH A . C 3 HOH 55 355 55 HOH HOH A . C 3 HOH 56 356 56 HOH HOH A . C 3 HOH 57 357 57 HOH HOH A . C 3 HOH 58 358 58 HOH HOH A . C 3 HOH 59 359 59 HOH HOH A . C 3 HOH 60 360 60 HOH HOH A . C 3 HOH 61 361 61 HOH HOH A . C 3 HOH 62 362 62 HOH HOH A . C 3 HOH 63 363 63 HOH HOH A . C 3 HOH 64 364 64 HOH HOH A . C 3 HOH 65 365 65 HOH HOH A . C 3 HOH 66 366 66 HOH HOH A . C 3 HOH 67 367 67 HOH HOH A . C 3 HOH 68 368 68 HOH HOH A . C 3 HOH 69 369 69 HOH HOH A . C 3 HOH 70 370 70 HOH HOH A . C 3 HOH 71 371 71 HOH HOH A . C 3 HOH 72 372 72 HOH HOH A . C 3 HOH 73 373 73 HOH HOH A . C 3 HOH 74 374 74 HOH HOH A . C 3 HOH 75 375 75 HOH HOH A . C 3 HOH 76 376 76 HOH HOH A . C 3 HOH 77 377 77 HOH HOH A . C 3 HOH 78 378 78 HOH HOH A . C 3 HOH 79 379 79 HOH HOH A . C 3 HOH 80 380 80 HOH HOH A . C 3 HOH 81 381 81 HOH HOH A . C 3 HOH 82 382 82 HOH HOH A . C 3 HOH 83 383 83 HOH HOH A . C 3 HOH 84 384 84 HOH HOH A . C 3 HOH 85 385 85 HOH HOH A . C 3 HOH 86 386 86 HOH HOH A . C 3 HOH 87 387 87 HOH HOH A . C 3 HOH 88 388 88 HOH HOH A . C 3 HOH 89 389 89 HOH HOH A . C 3 HOH 90 390 90 HOH HOH A . C 3 HOH 91 391 91 HOH HOH A . C 3 HOH 92 392 92 HOH HOH A . C 3 HOH 93 393 93 HOH HOH A . C 3 HOH 94 394 94 HOH HOH A . C 3 HOH 95 395 95 HOH HOH A . C 3 HOH 96 396 96 HOH HOH A . C 3 HOH 97 397 97 HOH HOH A . C 3 HOH 98 398 98 HOH HOH A . C 3 HOH 99 399 99 HOH HOH A . C 3 HOH 100 400 100 HOH HOH A . C 3 HOH 101 401 101 HOH HOH A . C 3 HOH 102 402 102 HOH HOH A . C 3 HOH 103 403 103 HOH HOH A . C 3 HOH 104 404 104 HOH HOH A . C 3 HOH 105 405 105 HOH HOH A . C 3 HOH 106 406 106 HOH HOH A . C 3 HOH 107 407 107 HOH HOH A . C 3 HOH 108 408 108 HOH HOH A . C 3 HOH 109 409 109 HOH HOH A . C 3 HOH 110 410 110 HOH HOH A . C 3 HOH 111 411 111 HOH HOH A . C 3 HOH 112 412 112 HOH HOH A . C 3 HOH 113 413 113 HOH HOH A . C 3 HOH 114 414 114 HOH HOH A . C 3 HOH 115 415 115 HOH HOH A . C 3 HOH 116 416 116 HOH HOH A . C 3 HOH 117 417 117 HOH HOH A . C 3 HOH 118 418 118 HOH HOH A . C 3 HOH 119 419 119 HOH HOH A . C 3 HOH 120 420 120 HOH HOH A . C 3 HOH 121 421 121 HOH HOH A . C 3 HOH 122 422 122 HOH HOH A . C 3 HOH 123 423 123 HOH HOH A . C 3 HOH 124 424 124 HOH HOH A . C 3 HOH 125 425 125 HOH HOH A . C 3 HOH 126 426 126 HOH HOH A . C 3 HOH 127 427 127 HOH HOH A . C 3 HOH 128 428 128 HOH HOH A . C 3 HOH 129 429 129 HOH HOH A . C 3 HOH 130 430 130 HOH HOH A . C 3 HOH 131 431 131 HOH HOH A . C 3 HOH 132 432 132 HOH HOH A . C 3 HOH 133 433 133 HOH HOH A . C 3 HOH 134 434 134 HOH HOH A . C 3 HOH 135 435 135 HOH HOH A . C 3 HOH 136 436 136 HOH HOH A . C 3 HOH 137 437 137 HOH HOH A . C 3 HOH 138 438 138 HOH HOH A . C 3 HOH 139 439 139 HOH HOH A . C 3 HOH 140 440 140 HOH HOH A . C 3 HOH 141 441 141 HOH HOH A . C 3 HOH 142 442 142 HOH HOH A . C 3 HOH 143 443 143 HOH HOH A . C 3 HOH 144 444 144 HOH HOH A . C 3 HOH 145 445 145 HOH HOH A . C 3 HOH 146 446 146 HOH HOH A . C 3 HOH 147 447 147 HOH HOH A . C 3 HOH 148 448 148 HOH HOH A . C 3 HOH 149 449 149 HOH HOH A . C 3 HOH 150 450 150 HOH HOH A . C 3 HOH 151 451 151 HOH HOH A . C 3 HOH 152 452 152 HOH HOH A . C 3 HOH 153 453 153 HOH HOH A . C 3 HOH 154 454 154 HOH HOH A . C 3 HOH 155 455 155 HOH HOH A . C 3 HOH 156 456 156 HOH HOH A . C 3 HOH 157 457 157 HOH HOH A . C 3 HOH 158 458 158 HOH HOH A . C 3 HOH 159 459 159 HOH HOH A . C 3 HOH 160 460 160 HOH HOH A . C 3 HOH 161 461 161 HOH HOH A . C 3 HOH 162 462 162 HOH HOH A . C 3 HOH 163 463 163 HOH HOH A . C 3 HOH 164 464 164 HOH HOH A . C 3 HOH 165 465 165 HOH HOH A . C 3 HOH 166 466 166 HOH HOH A . C 3 HOH 167 467 167 HOH HOH A . C 3 HOH 168 468 168 HOH HOH A . C 3 HOH 169 469 169 HOH HOH A . C 3 HOH 170 470 170 HOH HOH A . C 3 HOH 171 471 171 HOH HOH A . C 3 HOH 172 472 172 HOH HOH A . C 3 HOH 173 473 173 HOH HOH A . C 3 HOH 174 474 174 HOH HOH A . C 3 HOH 175 475 175 HOH HOH A . C 3 HOH 176 476 176 HOH HOH A . C 3 HOH 177 477 177 HOH HOH A . C 3 HOH 178 478 178 HOH HOH A . C 3 HOH 179 479 179 HOH HOH A . C 3 HOH 180 480 180 HOH HOH A . C 3 HOH 181 481 181 HOH HOH A . C 3 HOH 182 482 182 HOH HOH A . C 3 HOH 183 483 183 HOH HOH A . C 3 HOH 184 484 184 HOH HOH A . C 3 HOH 185 485 185 HOH HOH A . C 3 HOH 186 486 186 HOH HOH A . C 3 HOH 187 487 187 HOH HOH A . C 3 HOH 188 488 188 HOH HOH A . C 3 HOH 189 489 190 HOH HOH A . C 3 HOH 190 490 191 HOH HOH A . C 3 HOH 191 491 192 HOH HOH A . C 3 HOH 192 492 193 HOH HOH A . C 3 HOH 193 493 194 HOH HOH A . C 3 HOH 194 494 195 HOH HOH A . C 3 HOH 195 495 196 HOH HOH A . C 3 HOH 196 496 197 HOH HOH A . C 3 HOH 197 497 198 HOH HOH A . C 3 HOH 198 498 199 HOH HOH A . C 3 HOH 199 499 200 HOH HOH A . C 3 HOH 200 500 201 HOH HOH A . C 3 HOH 201 501 202 HOH HOH A . C 3 HOH 202 502 203 HOH HOH A . C 3 HOH 203 503 204 HOH HOH A . C 3 HOH 204 504 205 HOH HOH A . C 3 HOH 205 505 206 HOH HOH A . C 3 HOH 206 506 207 HOH HOH A . C 3 HOH 207 507 208 HOH HOH A . C 3 HOH 208 508 209 HOH HOH A . C 3 HOH 209 509 210 HOH HOH A . C 3 HOH 210 510 211 HOH HOH A . C 3 HOH 211 511 212 HOH HOH A . C 3 HOH 212 512 213 HOH HOH A . C 3 HOH 213 513 214 HOH HOH A . C 3 HOH 214 514 215 HOH HOH A . C 3 HOH 215 515 216 HOH HOH A . C 3 HOH 216 516 217 HOH HOH A . C 3 HOH 217 517 218 HOH HOH A . C 3 HOH 218 518 219 HOH HOH A . C 3 HOH 219 519 220 HOH HOH A . C 3 HOH 220 520 221 HOH HOH A . C 3 HOH 221 521 222 HOH HOH A . C 3 HOH 222 522 223 HOH HOH A . C 3 HOH 223 523 224 HOH HOH A . C 3 HOH 224 524 225 HOH HOH A . C 3 HOH 225 525 226 HOH HOH A . C 3 HOH 226 526 227 HOH HOH A . C 3 HOH 227 527 228 HOH HOH A . C 3 HOH 228 528 229 HOH HOH A . C 3 HOH 229 529 230 HOH HOH A . C 3 HOH 230 530 231 HOH HOH A . C 3 HOH 231 531 232 HOH HOH A . C 3 HOH 232 532 233 HOH HOH A . C 3 HOH 233 533 234 HOH HOH A . C 3 HOH 234 534 235 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 47 A MSE 49 ? MET SELENOMETHIONINE 2 A MSE 91 A MSE 93 ? MET SELENOMETHIONINE 3 A MSE 155 A MSE 157 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-14 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' struct_conn 3 3 'Structure model' struct_ref_seq_dif 4 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_phasing_MR.entry_id 2HZQ _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation ? _pdbx_phasing_MR.d_res_low_rotation ? _pdbx_phasing_MR.d_res_high_translation 4.000 _pdbx_phasing_MR.d_res_low_translation 15.000 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal SCALA . ? other 'Phil Evans' pre@mrc-lmb.cam.ac.uk 'data scaling' http://www.ccp4.ac.uk/dist/html/INDEX.html Fortran_77 ? 1 EPMR . ? other 'Charles R' crk@agouron.com phasing http://www.msg.ucsf.edu/local/programs/epmr/epmr.html ? ? 2 REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 3 PDB_EXTRACT 2.000 'April. 3, 2006' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 4 ADSC Quantum ? ? ? ? 'data collection' ? ? ? 5 MOSFLM . ? ? ? ? 'data reduction' ? ? ? 6 REFMAC 5.2.0003 ? ? ? ? phasing ? ? ? 7 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 50 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 N _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 ASN _pdbx_validate_rmsd_bond.auth_seq_id_2 51 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 0.995 _pdbx_validate_rmsd_bond.bond_target_value 1.336 _pdbx_validate_rmsd_bond.bond_deviation -0.341 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.023 _pdbx_validate_rmsd_bond.linker_flag Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A ASN 38 ? ? CA A ASN 38 ? ? C A ASN 38 ? ? 137.90 111.00 26.90 2.70 N 2 1 C A MSE 49 ? ? N A GLU 50 ? ? CA A GLU 50 ? ? 143.02 121.70 21.32 2.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 105 ? ? 63.39 -25.41 2 1 ASN A 107 ? ? -133.73 -52.38 3 1 SER A 118 ? ? 64.43 174.28 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLU _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 37 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ASN _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 38 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -122.77 # _pdbx_validate_polymer_linkage.id 1 _pdbx_validate_polymer_linkage.PDB_model_num 1 _pdbx_validate_polymer_linkage.auth_atom_id_1 C _pdbx_validate_polymer_linkage.auth_asym_id_1 A _pdbx_validate_polymer_linkage.auth_comp_id_1 GLU _pdbx_validate_polymer_linkage.auth_seq_id_1 50 _pdbx_validate_polymer_linkage.PDB_ins_code_1 ? _pdbx_validate_polymer_linkage.label_alt_id_1 ? _pdbx_validate_polymer_linkage.auth_atom_id_2 N _pdbx_validate_polymer_linkage.auth_asym_id_2 A _pdbx_validate_polymer_linkage.auth_comp_id_2 ASN _pdbx_validate_polymer_linkage.auth_seq_id_2 51 _pdbx_validate_polymer_linkage.PDB_ins_code_2 ? _pdbx_validate_polymer_linkage.label_alt_id_2 ? _pdbx_validate_polymer_linkage.dist 1.00 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 0 A GLU 50 ? A GLU 48 2 1 Y 1 A SER 169 ? A SER 167 3 1 Y 1 A ALA 170 ? A ALA 168 4 1 Y 1 A HIS 171 ? A HIS 169 5 1 Y 1 A HIS 172 ? A HIS 170 6 1 Y 1 A HIS 173 ? A HIS 171 7 1 Y 1 A HIS 174 ? A HIS 172 8 1 Y 1 A HIS 175 ? A HIS 173 9 1 Y 1 A HIS 176 ? A HIS 174 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 PROGESTERONE STR 3 water HOH #