data_2I18 # _entry.id 2I18 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2I18 pdb_00002i18 10.2210/pdb2i18/pdb RCSB RCSB039009 ? ? WWPDB D_1000039009 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-08-22 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-01-31 5 'Structure model' 1 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Structure summary' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' audit_author 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_nmr_spectrometer 8 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_audit_author.name' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_pdbx_nmr_spectrometer.model' 5 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2006-08-22 _pdbx_database_PDB_obs_spr.pdb_id 2I18 _pdbx_database_PDB_obs_spr.replace_pdb_id 2EV7 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2I18 _pdbx_database_status.recvd_initial_deposition_date 2006-08-13 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1JFK 'Minimum energy representative structure of a calcium bound EF-hand protein from Entamoeba histolytica' unspecified PDB 1JFJ 'NMR Solution structure of an EF-hand calcium binding protein from Entamoeba histolytica' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mustafi, S.M.' 1 'Mukherjee, S.' 2 'Chary, K.V.R.' 3 # _citation.id primary _citation.title 'Structural basis for the observed differential magnetic anisotropic tensorial values in calcium binding proteins.' _citation.journal_abbrev Proteins _citation.journal_volume 65 _citation.page_first 656 _citation.page_last 669 _citation.year 2006 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16981203 _citation.pdbx_database_id_DOI 10.1002/prot.21121 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mustafi, S.M.' 1 ? primary 'Mukherjee, S.' 2 ? primary 'Chary, K.V.' 3 ? primary 'Cavallaro, G.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Calcium-binding protein' 7195.175 1 ? ? 'C-terminal Domain, residues 71-134' ? 2 non-polymer syn 'LANTHANUM (III) ION' 138.905 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name CABP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SDDKIGLKVLYKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL _entity_poly.pdbx_seq_one_letter_code_can SDDKIGLKVLYKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'LANTHANUM (III) ION' _pdbx_entity_nonpoly.comp_id LA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASP n 1 3 ASP n 1 4 LYS n 1 5 ILE n 1 6 GLY n 1 7 LEU n 1 8 LYS n 1 9 VAL n 1 10 LEU n 1 11 TYR n 1 12 LYS n 1 13 LEU n 1 14 MET n 1 15 ASP n 1 16 VAL n 1 17 ASP n 1 18 GLY n 1 19 ASP n 1 20 GLY n 1 21 LYS n 1 22 LEU n 1 23 THR n 1 24 LYS n 1 25 GLU n 1 26 GLU n 1 27 VAL n 1 28 THR n 1 29 SER n 1 30 PHE n 1 31 PHE n 1 32 LYS n 1 33 LYS n 1 34 HIS n 1 35 GLY n 1 36 ILE n 1 37 GLU n 1 38 LYS n 1 39 VAL n 1 40 ALA n 1 41 GLU n 1 42 GLN n 1 43 VAL n 1 44 MET n 1 45 LYS n 1 46 ALA n 1 47 ASP n 1 48 ALA n 1 49 ASN n 1 50 GLY n 1 51 ASP n 1 52 GLY n 1 53 TYR n 1 54 ILE n 1 55 THR n 1 56 LEU n 1 57 GLU n 1 58 GLU n 1 59 PHE n 1 60 LEU n 1 61 GLU n 1 62 PHE n 1 63 SER n 1 64 LEU n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Entamoeba histolytica' _entity_src_nat.pdbx_ncbi_taxonomy_id 5759 _entity_src_nat.genus Entamoeba _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LA non-polymer . 'LANTHANUM (III) ION' ? 'La 3' 138.905 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 LEU 64 64 64 LEU LEU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id LA _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 226 _pdbx_nonpoly_scheme.auth_seq_num 226 _pdbx_nonpoly_scheme.pdb_mon_id LA _pdbx_nonpoly_scheme.auth_mon_id LA _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 2I18 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2I18 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 2I18 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 2I18 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2I18 _struct.title 'The refined structure of C-terminal domain of an EF-hand Calcium binding Protein from Entamoeba Histolytica' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2I18 _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'BETA SHEET, ALPHA HELIX, CALCIUM BINDING LOOPS, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CALBP_ENTHI _struct_ref.pdbx_db_accession P38505 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SDDKIGLKVLYKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKADANGDGYITLEEFLEFSL _struct_ref.pdbx_align_begin 71 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2I18 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P38505 _struct_ref_seq.db_align_beg 71 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 134 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 64 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 4 ? ASP A 15 ? LYS A 4 ASP A 15 1 ? 12 HELX_P HELX_P2 2 LYS A 24 ? LYS A 32 ? LYS A 24 LYS A 32 1 ? 9 HELX_P HELX_P3 3 GLY A 35 ? ALA A 48 ? GLY A 35 ALA A 48 1 ? 14 HELX_P HELX_P4 4 LEU A 56 ? LEU A 64 ? LEU A 56 LEU A 64 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 21 ? THR A 23 ? LYS A 21 THR A 23 A 2 TYR A 53 ? THR A 55 ? TYR A 53 THR A 55 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 22 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 22 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 54 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 54 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id LA _struct_site.pdbx_auth_seq_id 226 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE LA A 226' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 15 ? ASP A 15 . ? 1_555 ? 2 AC1 6 ASP A 17 ? ASP A 17 . ? 1_555 ? 3 AC1 6 GLY A 18 ? GLY A 18 . ? 1_555 ? 4 AC1 6 ASP A 19 ? ASP A 19 . ? 1_555 ? 5 AC1 6 LYS A 21 ? LYS A 21 . ? 1_555 ? 6 AC1 6 GLU A 26 ? GLU A 26 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A VAL 27 ? ? H A PHE 31 ? ? 1.38 2 1 O A LYS 8 ? ? H A LYS 12 ? ? 1.47 3 1 O A THR 55 ? ? H A PHE 59 ? ? 1.48 4 1 O A GLY 35 ? ? H A VAL 39 ? ? 1.51 5 1 O A VAL 39 ? ? H A VAL 43 ? ? 1.53 6 1 OE1 A GLU 26 ? ? LA A LA 226 ? ? 2.17 7 2 O A VAL 27 ? ? H A PHE 31 ? ? 1.39 8 2 O A THR 55 ? ? H A PHE 59 ? ? 1.45 9 2 O A VAL 43 ? ? H A ASP 47 ? ? 1.48 10 2 O A LYS 8 ? ? H A LYS 12 ? ? 1.49 11 2 O A LYS 4 ? ? H A LYS 8 ? ? 1.52 12 2 O A VAL 39 ? ? H A VAL 43 ? ? 1.53 13 2 OE1 A GLU 26 ? ? LA A LA 226 ? ? 1.88 14 3 O A VAL 27 ? ? H A PHE 31 ? ? 1.35 15 3 O A THR 55 ? ? H A PHE 59 ? ? 1.42 16 3 O A LYS 8 ? ? H A LYS 12 ? ? 1.51 17 3 O A VAL 43 ? ? H A ASP 47 ? ? 1.54 18 3 O A VAL 39 ? ? H A VAL 43 ? ? 1.54 19 3 O A ILE 36 ? ? H A ALA 40 ? ? 1.55 20 3 O A LEU 22 ? ? H A ILE 54 ? ? 1.58 21 3 OE1 A GLU 26 ? ? LA A LA 226 ? ? 2.09 22 4 O A VAL 27 ? ? H A PHE 31 ? ? 1.38 23 4 O A THR 55 ? ? H A PHE 59 ? ? 1.46 24 4 HH A TYR 11 ? ? O A GLY 20 ? ? 1.47 25 4 O A VAL 39 ? ? H A VAL 43 ? ? 1.47 26 4 O A VAL 43 ? ? H A ASP 47 ? ? 1.50 27 4 O A LYS 8 ? ? H A LYS 12 ? ? 1.51 28 4 O A GLU 58 ? ? H A PHE 62 ? ? 1.54 29 4 O A TYR 11 ? ? H A ASP 15 ? ? 1.54 30 4 O A LEU 60 ? ? H A LEU 64 ? ? 1.55 31 4 OE1 A GLU 26 ? ? LA A LA 226 ? ? 1.72 32 4 OD1 A ASP 19 ? ? LA A LA 226 ? ? 1.74 33 5 O A VAL 27 ? ? H A PHE 31 ? ? 1.36 34 5 O A THR 55 ? ? H A PHE 59 ? ? 1.42 35 5 O A VAL 39 ? ? H A VAL 43 ? ? 1.50 36 5 O A LYS 8 ? ? H A LYS 12 ? ? 1.51 37 5 O A ILE 36 ? ? H A ALA 40 ? ? 1.52 38 5 O A VAL 43 ? ? H A ASP 47 ? ? 1.53 39 5 OE1 A GLU 26 ? ? LA A LA 226 ? ? 1.84 40 6 O A VAL 27 ? ? H A PHE 31 ? ? 1.40 41 6 O A THR 55 ? ? H A PHE 59 ? ? 1.44 42 6 O A VAL 43 ? ? H A ASP 47 ? ? 1.49 43 6 O A ILE 36 ? ? H A ALA 40 ? ? 1.55 44 6 O A VAL 39 ? ? H A VAL 43 ? ? 1.56 45 6 O A LYS 8 ? ? H A LYS 12 ? ? 1.56 46 7 O A VAL 27 ? ? H A PHE 31 ? ? 1.42 47 7 O A THR 55 ? ? H A PHE 59 ? ? 1.47 48 7 O A LYS 8 ? ? H A LYS 12 ? ? 1.49 49 7 O A GLY 35 ? ? H A VAL 39 ? ? 1.52 50 7 O A VAL 39 ? ? H A VAL 43 ? ? 1.54 51 7 O A VAL 43 ? ? H A ASP 47 ? ? 1.54 52 7 OE1 A GLU 26 ? ? LA A LA 226 ? ? 1.92 53 8 HA3 A GLY 18 ? ? LA A LA 226 ? ? 0.79 54 8 CA A GLY 18 ? ? LA A LA 226 ? ? 0.83 55 8 O A VAL 27 ? ? H A PHE 31 ? ? 1.37 56 8 O A THR 55 ? ? H A PHE 59 ? ? 1.47 57 8 O A VAL 39 ? ? H A VAL 43 ? ? 1.49 58 8 O A GLY 35 ? ? H A VAL 39 ? ? 1.50 59 8 N A GLY 18 ? ? LA A LA 226 ? ? 1.54 60 8 O A LEU 22 ? ? H A ILE 54 ? ? 1.56 61 8 C A GLY 18 ? ? LA A LA 226 ? ? 1.73 62 9 O A VAL 27 ? ? H A PHE 31 ? ? 1.38 63 9 O A THR 55 ? ? H A PHE 59 ? ? 1.43 64 9 HH A TYR 11 ? ? O A GLY 20 ? ? 1.47 65 9 O A ILE 36 ? ? H A ALA 40 ? ? 1.47 66 9 O A VAL 43 ? ? H A ASP 47 ? ? 1.51 67 9 O A LYS 8 ? ? H A LYS 12 ? ? 1.56 68 9 O A ALA 40 ? ? H A MET 44 ? ? 1.57 69 9 O A LEU 22 ? ? H A ILE 54 ? ? 1.57 70 9 O A VAL 39 ? ? H A VAL 43 ? ? 1.58 71 9 OE1 A GLU 26 ? ? LA A LA 226 ? ? 2.01 72 10 O A VAL 27 ? ? H A PHE 31 ? ? 1.37 73 10 O A THR 55 ? ? H A PHE 59 ? ? 1.43 74 10 O A LYS 8 ? ? H A LYS 12 ? ? 1.49 75 10 HH A TYR 11 ? ? O A GLY 20 ? ? 1.50 76 10 O A GLY 35 ? ? H A VAL 39 ? ? 1.50 77 10 O A ILE 5 ? ? H A VAL 9 ? ? 1.58 78 10 O A VAL 39 ? ? H A VAL 43 ? ? 1.59 79 10 OE2 A GLU 26 ? ? LA A LA 226 ? ? 1.81 80 11 O A VAL 27 ? ? H A PHE 31 ? ? 1.37 81 11 OD1 A ASP 47 ? ? H A GLY 52 ? ? 1.49 82 11 O A VAL 39 ? ? H A VAL 43 ? ? 1.50 83 11 O A THR 55 ? ? H A PHE 59 ? ? 1.51 84 11 O A ILE 36 ? ? H A ALA 40 ? ? 1.51 85 11 O A LYS 38 ? ? H A GLN 42 ? ? 1.54 86 11 O A LEU 22 ? ? H A ILE 54 ? ? 1.60 87 11 OE1 A GLU 26 ? ? LA A LA 226 ? ? 1.76 88 12 O A VAL 27 ? ? H A PHE 31 ? ? 1.38 89 12 O A THR 55 ? ? H A PHE 59 ? ? 1.43 90 12 O A LYS 8 ? ? H A LYS 12 ? ? 1.50 91 12 O A SER 1 ? ? H A LYS 4 ? ? 1.51 92 12 O A ILE 36 ? ? H A ALA 40 ? ? 1.54 93 12 O A VAL 39 ? ? H A VAL 43 ? ? 1.55 94 12 O A LEU 22 ? ? H A ILE 54 ? ? 1.59 95 12 OE1 A GLU 26 ? ? LA A LA 226 ? ? 1.87 96 13 O A VAL 27 ? ? H A PHE 31 ? ? 1.40 97 13 O A THR 55 ? ? H A PHE 59 ? ? 1.44 98 13 O A VAL 39 ? ? H A VAL 43 ? ? 1.48 99 13 O A GLY 35 ? ? H A VAL 39 ? ? 1.50 100 13 O A VAL 43 ? ? H A ASP 47 ? ? 1.52 101 13 HH A TYR 11 ? ? O A GLY 20 ? ? 1.54 102 13 OD1 A ASP 19 ? ? LA A LA 226 ? ? 2.03 103 13 OE1 A GLU 26 ? ? LA A LA 226 ? ? 2.09 104 14 HA3 A GLY 18 ? ? LA A LA 226 ? ? 0.92 105 14 CA A GLY 18 ? ? LA A LA 226 ? ? 0.92 106 14 O A VAL 27 ? ? H A PHE 31 ? ? 1.39 107 14 O A THR 55 ? ? H A PHE 59 ? ? 1.42 108 14 O A VAL 39 ? ? H A VAL 43 ? ? 1.51 109 14 OD1 A ASP 47 ? ? H A GLY 52 ? ? 1.51 110 14 O A LYS 8 ? ? H A LYS 12 ? ? 1.52 111 14 N A GLY 18 ? ? LA A LA 226 ? ? 1.53 112 14 O A GLY 35 ? ? H A VAL 39 ? ? 1.53 113 14 O A LEU 10 ? ? H A MET 14 ? ? 1.53 114 14 O A LEU 22 ? ? H A ILE 54 ? ? 1.58 115 14 O A TYR 11 ? ? H A ASP 15 ? ? 1.59 116 14 C A GLY 18 ? ? LA A LA 226 ? ? 1.71 117 14 N A ASP 19 ? ? LA A LA 226 ? ? 2.17 118 15 O A VAL 27 ? ? H A PHE 31 ? ? 1.38 119 15 O A THR 55 ? ? H A PHE 59 ? ? 1.41 120 15 O A ILE 36 ? ? H A ALA 40 ? ? 1.48 121 15 HB3 A ASP 17 ? ? LA A LA 226 ? ? 1.48 122 15 O A VAL 43 ? ? H A ASP 47 ? ? 1.51 123 15 O A VAL 39 ? ? H A VAL 43 ? ? 1.55 124 15 O A LYS 8 ? ? H A LYS 12 ? ? 1.57 125 16 O A VAL 27 ? ? H A PHE 31 ? ? 1.35 126 16 O A THR 55 ? ? H A PHE 59 ? ? 1.45 127 16 O A LYS 8 ? ? H A LYS 12 ? ? 1.50 128 16 O A ILE 36 ? ? H A ALA 40 ? ? 1.53 129 16 O A ILE 5 ? ? H A VAL 9 ? ? 1.56 130 16 HH A TYR 11 ? ? O A ILE 54 ? ? 1.56 131 16 O A VAL 39 ? ? H A VAL 43 ? ? 1.57 132 16 H A ASP 17 ? ? OE2 A GLU 26 ? ? 1.59 133 16 OE1 A GLU 26 ? ? LA A LA 226 ? ? 1.79 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 4 ? ? -170.30 33.32 2 1 ASP A 15 ? ? -40.34 96.62 3 1 ASP A 17 ? ? -38.87 -78.59 4 1 ASP A 19 ? ? -159.56 -49.04 5 1 VAL A 27 ? ? -67.16 -71.29 6 1 HIS A 34 ? ? -67.04 -130.67 7 1 ILE A 36 ? ? -36.37 -33.12 8 1 GLU A 37 ? ? -65.33 -70.51 9 1 ALA A 48 ? ? 39.05 49.58 10 1 ASN A 49 ? ? -146.70 -46.95 11 1 ASP A 51 ? ? 176.38 66.78 12 2 ASP A 3 ? ? -80.80 49.19 13 2 LYS A 4 ? ? 173.51 -32.26 14 2 ASP A 15 ? ? -38.20 98.04 15 2 ASP A 17 ? ? -38.74 -71.79 16 2 VAL A 27 ? ? -68.69 -71.14 17 2 HIS A 34 ? ? -106.22 -132.77 18 2 ILE A 36 ? ? -29.80 -44.62 19 2 ASP A 51 ? ? 159.07 70.27 20 3 ASP A 15 ? ? -53.22 90.49 21 3 ASP A 17 ? ? -39.43 -34.02 22 3 ASP A 19 ? ? -161.00 -53.90 23 3 VAL A 27 ? ? -70.09 -70.93 24 3 HIS A 34 ? ? -93.84 -129.90 25 3 ILE A 36 ? ? -29.86 -53.58 26 3 ASP A 47 ? ? -101.78 56.00 27 3 ASP A 51 ? ? 175.69 57.36 28 4 ASP A 15 ? ? -43.55 96.85 29 4 ASP A 17 ? ? -148.87 -57.15 30 4 ASP A 19 ? ? -137.40 -48.09 31 4 VAL A 27 ? ? -67.45 -71.25 32 4 HIS A 34 ? ? -79.32 -129.40 33 4 LYS A 38 ? ? -61.64 -70.14 34 4 ALA A 48 ? ? -101.83 79.49 35 4 ASN A 49 ? ? -169.79 -41.87 36 4 ASP A 51 ? ? 156.15 70.44 37 5 ASP A 2 ? ? 76.53 -56.03 38 5 ASP A 3 ? ? 158.38 -27.21 39 5 LYS A 4 ? ? -162.86 28.31 40 5 ASP A 15 ? ? -52.16 94.06 41 5 VAL A 27 ? ? -69.46 -70.24 42 5 HIS A 34 ? ? -104.50 -129.04 43 5 ILE A 36 ? ? -34.97 -34.97 44 5 GLU A 37 ? ? -48.83 -70.90 45 5 ASP A 47 ? ? -104.80 61.27 46 5 ASP A 51 ? ? 173.38 60.82 47 6 LYS A 4 ? ? 178.14 -35.24 48 6 ILE A 5 ? ? -39.19 -31.11 49 6 ASP A 15 ? ? -39.46 97.83 50 6 ASP A 17 ? ? -174.78 -61.93 51 6 ASP A 19 ? ? -163.15 -49.48 52 6 VAL A 27 ? ? -69.79 -71.18 53 6 HIS A 34 ? ? -87.58 -128.38 54 6 ILE A 36 ? ? -29.74 -47.22 55 6 ASP A 47 ? ? -107.23 58.90 56 6 ASP A 51 ? ? 177.83 57.10 57 7 LYS A 4 ? ? 173.59 -32.96 58 7 ASP A 15 ? ? -48.12 93.85 59 7 ASP A 19 ? ? -168.01 -48.05 60 7 VAL A 27 ? ? -71.33 -71.22 61 7 THR A 28 ? ? -38.11 -39.13 62 7 HIS A 34 ? ? -61.42 -122.46 63 7 ILE A 36 ? ? -35.53 -33.95 64 7 GLU A 37 ? ? -65.67 -71.16 65 7 ASP A 47 ? ? -86.35 48.04 66 7 ASN A 49 ? ? -171.26 -41.11 67 7 ASP A 51 ? ? 161.08 75.96 68 8 LYS A 4 ? ? -160.27 30.88 69 8 ASP A 15 ? ? -41.60 96.71 70 8 ASP A 19 ? ? 48.51 24.21 71 8 VAL A 27 ? ? -65.71 -70.83 72 8 HIS A 34 ? ? -66.15 -126.78 73 8 ILE A 36 ? ? -35.67 -33.96 74 8 GLU A 37 ? ? -65.46 -70.78 75 8 ALA A 48 ? ? -89.14 47.31 76 8 ASP A 51 ? ? 165.85 67.34 77 9 ASP A 15 ? ? -48.21 94.21 78 9 ASP A 17 ? ? -41.09 -81.96 79 9 ASP A 19 ? ? -161.78 -44.24 80 9 VAL A 27 ? ? -70.32 -70.70 81 9 HIS A 34 ? ? -89.36 -137.32 82 9 ILE A 36 ? ? -29.18 -45.40 83 9 GLU A 37 ? ? -30.88 -70.38 84 9 ALA A 48 ? ? -92.58 38.04 85 9 ASP A 51 ? ? 157.23 69.81 86 10 ASP A 2 ? ? -47.14 -75.13 87 10 ASP A 15 ? ? -38.23 99.02 88 10 ASP A 17 ? ? -168.11 -68.57 89 10 ASP A 19 ? ? -137.33 -47.04 90 10 VAL A 27 ? ? -69.28 -71.71 91 10 HIS A 34 ? ? -70.33 -126.61 92 10 ILE A 36 ? ? -36.36 -33.77 93 10 GLU A 37 ? ? -65.43 -70.03 94 10 ALA A 48 ? ? 63.46 -79.21 95 10 ASP A 51 ? ? 173.57 49.88 96 11 ASP A 15 ? ? -48.40 95.09 97 11 ASP A 19 ? ? -121.54 -51.46 98 11 VAL A 27 ? ? -68.59 -70.14 99 11 HIS A 34 ? ? -73.42 -129.63 100 11 ILE A 36 ? ? -33.71 -37.46 101 11 GLU A 37 ? ? -48.18 -71.69 102 11 ALA A 48 ? ? 70.43 -59.56 103 11 ASP A 51 ? ? 173.32 66.88 104 12 ASP A 2 ? ? -39.92 -29.91 105 12 LYS A 4 ? ? -162.75 28.88 106 12 ASP A 15 ? ? -42.88 96.62 107 12 ASP A 19 ? ? -139.51 -46.71 108 12 HIS A 34 ? ? -93.80 -136.30 109 12 GLU A 37 ? ? -33.40 -70.13 110 12 ALA A 48 ? ? -107.92 78.84 111 12 ASN A 49 ? ? -169.19 -41.90 112 12 ASP A 51 ? ? 155.61 67.70 113 13 ASP A 3 ? ? 84.91 -55.60 114 13 LYS A 4 ? ? -166.97 59.30 115 13 ASP A 15 ? ? -44.81 95.13 116 13 ASP A 19 ? ? -162.16 -45.85 117 13 VAL A 27 ? ? -68.09 -70.60 118 13 LYS A 32 ? ? -39.14 -30.87 119 13 HIS A 34 ? ? -65.81 -124.85 120 13 ILE A 36 ? ? -35.93 -32.81 121 13 ALA A 48 ? ? 67.59 -75.20 122 13 ASP A 51 ? ? 172.20 50.28 123 14 ASP A 15 ? ? -39.69 98.35 124 14 ASP A 19 ? ? 47.94 26.94 125 14 VAL A 27 ? ? -70.06 -71.02 126 14 LYS A 32 ? ? -38.83 -30.94 127 14 HIS A 34 ? ? -63.06 -130.74 128 14 ILE A 36 ? ? -37.36 -31.86 129 14 GLU A 37 ? ? -65.67 -70.70 130 14 ALA A 48 ? ? 73.26 -58.62 131 14 ASP A 51 ? ? 178.23 59.39 132 15 LEU A 10 ? ? -50.06 -70.46 133 15 MET A 14 ? ? -63.01 -70.77 134 15 ASP A 15 ? ? 39.42 91.90 135 15 VAL A 16 ? ? -111.43 56.02 136 15 ASP A 17 ? ? -147.29 -58.98 137 15 ASP A 19 ? ? -167.94 -42.53 138 15 LYS A 24 ? ? -54.32 -70.40 139 15 HIS A 34 ? ? -81.45 -134.21 140 15 ILE A 36 ? ? -29.23 -49.99 141 15 ASP A 51 ? ? 177.58 60.40 142 16 ASP A 15 ? ? -61.53 86.57 143 16 VAL A 27 ? ? -70.66 -71.48 144 16 LYS A 32 ? ? -39.70 -29.73 145 16 HIS A 34 ? ? -67.44 -134.29 146 16 ILE A 36 ? ? -29.05 -50.02 147 16 GLU A 37 ? ? -33.22 -70.69 148 16 ALA A 48 ? ? 65.85 -75.99 149 16 ASP A 51 ? ? 162.68 61.73 # _pdbx_nmr_ensemble.entry_id 2I18 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 16 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2I18 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1MM EHCABP U-15, 13C, 50MM Tris buffer, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 4.5 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 3 1 '15N-1H HSQC' 1 # _pdbx_nmr_details.entry_id 2I18 _pdbx_nmr_details.text 'The refinement is done using 6 lanthanide ions' # _pdbx_nmr_refine.entry_id 2I18 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name PSEUDYANA _pdbx_nmr_software.version 1.5 _pdbx_nmr_software.authors Banci,L _pdbx_nmr_software.ordinal 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 HIS N N N N 96 HIS CA C N S 97 HIS C C N N 98 HIS O O N N 99 HIS CB C N N 100 HIS CG C Y N 101 HIS ND1 N Y N 102 HIS CD2 C Y N 103 HIS CE1 C Y N 104 HIS NE2 N Y N 105 HIS OXT O N N 106 HIS H H N N 107 HIS H2 H N N 108 HIS HA H N N 109 HIS HB2 H N N 110 HIS HB3 H N N 111 HIS HD1 H N N 112 HIS HD2 H N N 113 HIS HE1 H N N 114 HIS HE2 H N N 115 HIS HXT H N N 116 ILE N N N N 117 ILE CA C N S 118 ILE C C N N 119 ILE O O N N 120 ILE CB C N S 121 ILE CG1 C N N 122 ILE CG2 C N N 123 ILE CD1 C N N 124 ILE OXT O N N 125 ILE H H N N 126 ILE H2 H N N 127 ILE HA H N N 128 ILE HB H N N 129 ILE HG12 H N N 130 ILE HG13 H N N 131 ILE HG21 H N N 132 ILE HG22 H N N 133 ILE HG23 H N N 134 ILE HD11 H N N 135 ILE HD12 H N N 136 ILE HD13 H N N 137 ILE HXT H N N 138 LA LA LA N N 139 LEU N N N N 140 LEU CA C N S 141 LEU C C N N 142 LEU O O N N 143 LEU CB C N N 144 LEU CG C N N 145 LEU CD1 C N N 146 LEU CD2 C N N 147 LEU OXT O N N 148 LEU H H N N 149 LEU H2 H N N 150 LEU HA H N N 151 LEU HB2 H N N 152 LEU HB3 H N N 153 LEU HG H N N 154 LEU HD11 H N N 155 LEU HD12 H N N 156 LEU HD13 H N N 157 LEU HD21 H N N 158 LEU HD22 H N N 159 LEU HD23 H N N 160 LEU HXT H N N 161 LYS N N N N 162 LYS CA C N S 163 LYS C C N N 164 LYS O O N N 165 LYS CB C N N 166 LYS CG C N N 167 LYS CD C N N 168 LYS CE C N N 169 LYS NZ N N N 170 LYS OXT O N N 171 LYS H H N N 172 LYS H2 H N N 173 LYS HA H N N 174 LYS HB2 H N N 175 LYS HB3 H N N 176 LYS HG2 H N N 177 LYS HG3 H N N 178 LYS HD2 H N N 179 LYS HD3 H N N 180 LYS HE2 H N N 181 LYS HE3 H N N 182 LYS HZ1 H N N 183 LYS HZ2 H N N 184 LYS HZ3 H N N 185 LYS HXT H N N 186 MET N N N N 187 MET CA C N S 188 MET C C N N 189 MET O O N N 190 MET CB C N N 191 MET CG C N N 192 MET SD S N N 193 MET CE C N N 194 MET OXT O N N 195 MET H H N N 196 MET H2 H N N 197 MET HA H N N 198 MET HB2 H N N 199 MET HB3 H N N 200 MET HG2 H N N 201 MET HG3 H N N 202 MET HE1 H N N 203 MET HE2 H N N 204 MET HE3 H N N 205 MET HXT H N N 206 PHE N N N N 207 PHE CA C N S 208 PHE C C N N 209 PHE O O N N 210 PHE CB C N N 211 PHE CG C Y N 212 PHE CD1 C Y N 213 PHE CD2 C Y N 214 PHE CE1 C Y N 215 PHE CE2 C Y N 216 PHE CZ C Y N 217 PHE OXT O N N 218 PHE H H N N 219 PHE H2 H N N 220 PHE HA H N N 221 PHE HB2 H N N 222 PHE HB3 H N N 223 PHE HD1 H N N 224 PHE HD2 H N N 225 PHE HE1 H N N 226 PHE HE2 H N N 227 PHE HZ H N N 228 PHE HXT H N N 229 SER N N N N 230 SER CA C N S 231 SER C C N N 232 SER O O N N 233 SER CB C N N 234 SER OG O N N 235 SER OXT O N N 236 SER H H N N 237 SER H2 H N N 238 SER HA H N N 239 SER HB2 H N N 240 SER HB3 H N N 241 SER HG H N N 242 SER HXT H N N 243 THR N N N N 244 THR CA C N S 245 THR C C N N 246 THR O O N N 247 THR CB C N R 248 THR OG1 O N N 249 THR CG2 C N N 250 THR OXT O N N 251 THR H H N N 252 THR H2 H N N 253 THR HA H N N 254 THR HB H N N 255 THR HG1 H N N 256 THR HG21 H N N 257 THR HG22 H N N 258 THR HG23 H N N 259 THR HXT H N N 260 TYR N N N N 261 TYR CA C N S 262 TYR C C N N 263 TYR O O N N 264 TYR CB C N N 265 TYR CG C Y N 266 TYR CD1 C Y N 267 TYR CD2 C Y N 268 TYR CE1 C Y N 269 TYR CE2 C Y N 270 TYR CZ C Y N 271 TYR OH O N N 272 TYR OXT O N N 273 TYR H H N N 274 TYR H2 H N N 275 TYR HA H N N 276 TYR HB2 H N N 277 TYR HB3 H N N 278 TYR HD1 H N N 279 TYR HD2 H N N 280 TYR HE1 H N N 281 TYR HE2 H N N 282 TYR HH H N N 283 TYR HXT H N N 284 VAL N N N N 285 VAL CA C N S 286 VAL C C N N 287 VAL O O N N 288 VAL CB C N N 289 VAL CG1 C N N 290 VAL CG2 C N N 291 VAL OXT O N N 292 VAL H H N N 293 VAL H2 H N N 294 VAL HA H N N 295 VAL HB H N N 296 VAL HG11 H N N 297 VAL HG12 H N N 298 VAL HG13 H N N 299 VAL HG21 H N N 300 VAL HG22 H N N 301 VAL HG23 H N N 302 VAL HXT H N N 303 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 HIS N CA sing N N 90 HIS N H sing N N 91 HIS N H2 sing N N 92 HIS CA C sing N N 93 HIS CA CB sing N N 94 HIS CA HA sing N N 95 HIS C O doub N N 96 HIS C OXT sing N N 97 HIS CB CG sing N N 98 HIS CB HB2 sing N N 99 HIS CB HB3 sing N N 100 HIS CG ND1 sing Y N 101 HIS CG CD2 doub Y N 102 HIS ND1 CE1 doub Y N 103 HIS ND1 HD1 sing N N 104 HIS CD2 NE2 sing Y N 105 HIS CD2 HD2 sing N N 106 HIS CE1 NE2 sing Y N 107 HIS CE1 HE1 sing N N 108 HIS NE2 HE2 sing N N 109 HIS OXT HXT sing N N 110 ILE N CA sing N N 111 ILE N H sing N N 112 ILE N H2 sing N N 113 ILE CA C sing N N 114 ILE CA CB sing N N 115 ILE CA HA sing N N 116 ILE C O doub N N 117 ILE C OXT sing N N 118 ILE CB CG1 sing N N 119 ILE CB CG2 sing N N 120 ILE CB HB sing N N 121 ILE CG1 CD1 sing N N 122 ILE CG1 HG12 sing N N 123 ILE CG1 HG13 sing N N 124 ILE CG2 HG21 sing N N 125 ILE CG2 HG22 sing N N 126 ILE CG2 HG23 sing N N 127 ILE CD1 HD11 sing N N 128 ILE CD1 HD12 sing N N 129 ILE CD1 HD13 sing N N 130 ILE OXT HXT sing N N 131 LEU N CA sing N N 132 LEU N H sing N N 133 LEU N H2 sing N N 134 LEU CA C sing N N 135 LEU CA CB sing N N 136 LEU CA HA sing N N 137 LEU C O doub N N 138 LEU C OXT sing N N 139 LEU CB CG sing N N 140 LEU CB HB2 sing N N 141 LEU CB HB3 sing N N 142 LEU CG CD1 sing N N 143 LEU CG CD2 sing N N 144 LEU CG HG sing N N 145 LEU CD1 HD11 sing N N 146 LEU CD1 HD12 sing N N 147 LEU CD1 HD13 sing N N 148 LEU CD2 HD21 sing N N 149 LEU CD2 HD22 sing N N 150 LEU CD2 HD23 sing N N 151 LEU OXT HXT sing N N 152 LYS N CA sing N N 153 LYS N H sing N N 154 LYS N H2 sing N N 155 LYS CA C sing N N 156 LYS CA CB sing N N 157 LYS CA HA sing N N 158 LYS C O doub N N 159 LYS C OXT sing N N 160 LYS CB CG sing N N 161 LYS CB HB2 sing N N 162 LYS CB HB3 sing N N 163 LYS CG CD sing N N 164 LYS CG HG2 sing N N 165 LYS CG HG3 sing N N 166 LYS CD CE sing N N 167 LYS CD HD2 sing N N 168 LYS CD HD3 sing N N 169 LYS CE NZ sing N N 170 LYS CE HE2 sing N N 171 LYS CE HE3 sing N N 172 LYS NZ HZ1 sing N N 173 LYS NZ HZ2 sing N N 174 LYS NZ HZ3 sing N N 175 LYS OXT HXT sing N N 176 MET N CA sing N N 177 MET N H sing N N 178 MET N H2 sing N N 179 MET CA C sing N N 180 MET CA CB sing N N 181 MET CA HA sing N N 182 MET C O doub N N 183 MET C OXT sing N N 184 MET CB CG sing N N 185 MET CB HB2 sing N N 186 MET CB HB3 sing N N 187 MET CG SD sing N N 188 MET CG HG2 sing N N 189 MET CG HG3 sing N N 190 MET SD CE sing N N 191 MET CE HE1 sing N N 192 MET CE HE2 sing N N 193 MET CE HE3 sing N N 194 MET OXT HXT sing N N 195 PHE N CA sing N N 196 PHE N H sing N N 197 PHE N H2 sing N N 198 PHE CA C sing N N 199 PHE CA CB sing N N 200 PHE CA HA sing N N 201 PHE C O doub N N 202 PHE C OXT sing N N 203 PHE CB CG sing N N 204 PHE CB HB2 sing N N 205 PHE CB HB3 sing N N 206 PHE CG CD1 doub Y N 207 PHE CG CD2 sing Y N 208 PHE CD1 CE1 sing Y N 209 PHE CD1 HD1 sing N N 210 PHE CD2 CE2 doub Y N 211 PHE CD2 HD2 sing N N 212 PHE CE1 CZ doub Y N 213 PHE CE1 HE1 sing N N 214 PHE CE2 CZ sing Y N 215 PHE CE2 HE2 sing N N 216 PHE CZ HZ sing N N 217 PHE OXT HXT sing N N 218 SER N CA sing N N 219 SER N H sing N N 220 SER N H2 sing N N 221 SER CA C sing N N 222 SER CA CB sing N N 223 SER CA HA sing N N 224 SER C O doub N N 225 SER C OXT sing N N 226 SER CB OG sing N N 227 SER CB HB2 sing N N 228 SER CB HB3 sing N N 229 SER OG HG sing N N 230 SER OXT HXT sing N N 231 THR N CA sing N N 232 THR N H sing N N 233 THR N H2 sing N N 234 THR CA C sing N N 235 THR CA CB sing N N 236 THR CA HA sing N N 237 THR C O doub N N 238 THR C OXT sing N N 239 THR CB OG1 sing N N 240 THR CB CG2 sing N N 241 THR CB HB sing N N 242 THR OG1 HG1 sing N N 243 THR CG2 HG21 sing N N 244 THR CG2 HG22 sing N N 245 THR CG2 HG23 sing N N 246 THR OXT HXT sing N N 247 TYR N CA sing N N 248 TYR N H sing N N 249 TYR N H2 sing N N 250 TYR CA C sing N N 251 TYR CA CB sing N N 252 TYR CA HA sing N N 253 TYR C O doub N N 254 TYR C OXT sing N N 255 TYR CB CG sing N N 256 TYR CB HB2 sing N N 257 TYR CB HB3 sing N N 258 TYR CG CD1 doub Y N 259 TYR CG CD2 sing Y N 260 TYR CD1 CE1 sing Y N 261 TYR CD1 HD1 sing N N 262 TYR CD2 CE2 doub Y N 263 TYR CD2 HD2 sing N N 264 TYR CE1 CZ doub Y N 265 TYR CE1 HE1 sing N N 266 TYR CE2 CZ sing Y N 267 TYR CE2 HE2 sing N N 268 TYR CZ OH sing N N 269 TYR OH HH sing N N 270 TYR OXT HXT sing N N 271 VAL N CA sing N N 272 VAL N H sing N N 273 VAL N H2 sing N N 274 VAL CA C sing N N 275 VAL CA CB sing N N 276 VAL CA HA sing N N 277 VAL C O doub N N 278 VAL C OXT sing N N 279 VAL CB CG1 sing N N 280 VAL CB CG2 sing N N 281 VAL CB HB sing N N 282 VAL CG1 HG11 sing N N 283 VAL CG1 HG12 sing N N 284 VAL CG1 HG13 sing N N 285 VAL CG2 HG21 sing N N 286 VAL CG2 HG22 sing N N 287 VAL CG2 HG23 sing N N 288 VAL OXT HXT sing N N 289 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 750 ? 2 INOVA Varian 600 ? # _atom_sites.entry_id 2I18 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H LA N O S # loop_