data_2I8E # _entry.id 2I8E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.357 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2I8E pdb_00002i8e 10.2210/pdb2i8e/pdb RCSB RCSB039266 ? ? WWPDB D_1000039266 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC6107 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2I8E _pdbx_database_status.recvd_initial_deposition_date 2006-09-01 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, S.' 1 ? 'Zimmerman, M.D.' 2 ? 'Kudritska, M.' 3 ? 'Chruszcz, M.' 4 ? 'Savchenko, A.' 5 ? 'Edwards, A.' 6 ? 'Joachimiak, A.' 7 ? 'Minor, W.' 8 0000-0001-7075-7090 'Midwest Center for Structural Genomics (MCSG)' 9 ? # _citation.id primary _citation.title ;A novel family of sequence-specific endoribonucleases associated with the clustered regularly interspaced short palindromic repeats. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 283 _citation.page_first 20361 _citation.page_last 20371 _citation.year 2008 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18482976 _citation.pdbx_database_id_DOI 10.1074/jbc.M803225200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Beloglazova, N.' 1 ? primary 'Brown, G.' 2 ? primary 'Zimmerman, M.D.' 3 ? primary 'Proudfoot, M.' 4 ? primary 'Makarova, K.S.' 5 ? primary 'Kudritska, M.' 6 ? primary 'Kochinyan, S.' 7 ? primary 'Wang, S.' 8 ? primary 'Chruszcz, M.' 9 ? primary 'Minor, W.' 10 0000-0001-7075-7090 primary 'Koonin, E.V.' 11 ? primary 'Edwards, A.M.' 12 ? primary 'Savchenko, A.' 13 ? primary 'Yakunin, A.F.' 14 ? # _cell.entry_id 2I8E _cell.length_a 64.277 _cell.length_b 64.277 _cell.length_c 39.529 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2I8E _symmetry.space_group_name_H-M 'P 62' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 171 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hypothetical protein' 12093.465 1 ? ? ? ? 2 non-polymer syn 'IODIDE ION' 126.904 4 ? ? ? ? 3 water nat water 18.015 75 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)A(MSE)LYLIFYDITDDNLRNRVAEFLKKKGLDRIQYSVF(MSE)GDLNSSRLKDVEAGLKIIGNRKKLQEDERF FILIVPITENQFRERIVIGYSGSEREEKSNVVW ; _entity_poly.pdbx_seq_one_letter_code_can ;MAMLYLIFYDITDDNLRNRVAEFLKKKGLDRIQYSVFMGDLNSSRLKDVEAGLKIIGNRKKLQEDERFFILIVPITENQF RERIVIGYSGSEREEKSNVVW ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC6107 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ALA n 1 3 MSE n 1 4 LEU n 1 5 TYR n 1 6 LEU n 1 7 ILE n 1 8 PHE n 1 9 TYR n 1 10 ASP n 1 11 ILE n 1 12 THR n 1 13 ASP n 1 14 ASP n 1 15 ASN n 1 16 LEU n 1 17 ARG n 1 18 ASN n 1 19 ARG n 1 20 VAL n 1 21 ALA n 1 22 GLU n 1 23 PHE n 1 24 LEU n 1 25 LYS n 1 26 LYS n 1 27 LYS n 1 28 GLY n 1 29 LEU n 1 30 ASP n 1 31 ARG n 1 32 ILE n 1 33 GLN n 1 34 TYR n 1 35 SER n 1 36 VAL n 1 37 PHE n 1 38 MSE n 1 39 GLY n 1 40 ASP n 1 41 LEU n 1 42 ASN n 1 43 SER n 1 44 SER n 1 45 ARG n 1 46 LEU n 1 47 LYS n 1 48 ASP n 1 49 VAL n 1 50 GLU n 1 51 ALA n 1 52 GLY n 1 53 LEU n 1 54 LYS n 1 55 ILE n 1 56 ILE n 1 57 GLY n 1 58 ASN n 1 59 ARG n 1 60 LYS n 1 61 LYS n 1 62 LEU n 1 63 GLN n 1 64 GLU n 1 65 ASP n 1 66 GLU n 1 67 ARG n 1 68 PHE n 1 69 PHE n 1 70 ILE n 1 71 LEU n 1 72 ILE n 1 73 VAL n 1 74 PRO n 1 75 ILE n 1 76 THR n 1 77 GLU n 1 78 ASN n 1 79 GLN n 1 80 PHE n 1 81 ARG n 1 82 GLU n 1 83 ARG n 1 84 ILE n 1 85 VAL n 1 86 ILE n 1 87 GLY n 1 88 TYR n 1 89 SER n 1 90 GLY n 1 91 SER n 1 92 GLU n 1 93 ARG n 1 94 GLU n 1 95 GLU n 1 96 LYS n 1 97 SER n 1 98 ASN n 1 99 VAL n 1 100 VAL n 1 101 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Sulfolobus _entity_src_gen.pdbx_gene_src_gene SSO1404 _entity_src_gen.gene_src_species 'Sulfolobus solfataricus' _entity_src_gen.gene_src_strain P2 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sulfolobus solfataricus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 273057 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-CodonPlus(DE3)-RP' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'p15Tv lic' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q97YC2_SULSO _struct_ref.pdbx_db_accession Q97YC2 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2I8E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 101 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q97YC2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 101 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 101 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IOD non-polymer . 'IODIDE ION' ? 'I -1' 126.904 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2I8E _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.95 _exptl_crystal.density_percent_sol 36.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details 'Crystallized in 0.2M Na iodide, 20% PEG3350, 2% isopropanol, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 103 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type SBC-3 _diffrn_detector.pdbx_collection_date 2006-06-09 _diffrn_detector.details Mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97940 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-BM _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97940 # _reflns.entry_id 2I8E _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 1.59 _reflns.d_resolution_low 50 _reflns.number_all 12619 _reflns.number_obs 12619 _reflns.percent_possible_obs 99.5 _reflns.pdbx_Rmerge_I_obs 0.052 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 63.9 _reflns.B_iso_Wilson_estimate 27.3 _reflns.pdbx_redundancy 11.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.59 _reflns_shell.d_res_low 1.65 _reflns_shell.percent_possible_all 96.4 _reflns_shell.Rmerge_I_obs 0.309 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 8.2 _reflns_shell.pdbx_redundancy 10.3 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1219 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2I8E _refine.ls_number_reflns_obs 11992 _refine.ls_number_reflns_all 11992 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 24.94 _refine.ls_d_res_high 1.59 _refine.ls_percent_reflns_obs 99.90 _refine.ls_R_factor_obs 0.18972 _refine.ls_R_factor_all 0.18972 _refine.ls_R_factor_R_work 0.18783 _refine.ls_R_factor_R_free 0.22708 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 610 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.959 _refine.correlation_coeff_Fo_to_Fc_free 0.938 _refine.B_iso_mean 20.862 _refine.aniso_B[1][1] 0.46 _refine.aniso_B[2][2] 0.46 _refine.aniso_B[3][3] -0.69 _refine.aniso_B[1][2] 0.23 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ISOTROPIC _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.096 _refine.pdbx_overall_ESU_R_Free 0.098 _refine.overall_SU_ML 0.058 _refine.overall_SU_B 3.102 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2I8E _refine_analyze.Luzzati_coordinate_error_obs 0.205 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 730 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 75 _refine_hist.number_atoms_total 809 _refine_hist.d_res_high 1.59 _refine_hist.d_res_low 24.94 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.016 0.022 ? 800 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.692 1.979 ? 1083 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.524 5.000 ? 101 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 31.503 23.415 ? 41 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 15.235 15.000 ? 159 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 20.091 15.000 ? 8 'X-RAY DIFFRACTION' ? r_chiral_restr 0.112 0.200 ? 120 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.008 0.020 ? 609 'X-RAY DIFFRACTION' ? r_nbd_refined 0.215 0.200 ? 348 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.312 0.200 ? 570 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.178 0.200 ? 47 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.188 0.200 ? 63 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.335 0.200 ? 15 'X-RAY DIFFRACTION' ? r_mcbond_it 1.410 1.500 ? 475 'X-RAY DIFFRACTION' ? r_mcangle_it 1.646 2.000 ? 771 'X-RAY DIFFRACTION' ? r_scbond_it 3.270 3.000 ? 350 'X-RAY DIFFRACTION' ? r_scangle_it 4.571 4.500 ? 310 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.59 _refine_ls_shell.d_res_low 1.633 _refine_ls_shell.number_reflns_R_work 863 _refine_ls_shell.R_factor_R_work 0.159 _refine_ls_shell.percent_reflns_obs 99.56 _refine_ls_shell.R_factor_R_free 0.218 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 44 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2I8E _struct.title 'Structure of SSO1404, a predicted DNA repair-associated protein from Sulfolobus solfataricus P2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2I8E _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text 'DNA REPAIR, UNKNOWN FUNCTION, STRUCTURAL GENOMICS, MIDWEST CENTER FOR STRUCTURAL GENOMICS, MCSG, PSI, Protein Structure Initiative' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_biol.id 1 _struct_biol.details ;The biological assembly has not been determined experimentally. The biological unit is predicted by the PITA server (http://http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/pita/RunPita.pl) to be a dimer. The second part of the predicted biological assembly is generated by the operation: -x, -y-1, z. ; _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 13 ? GLY A 28 ? ASP A 13 GLY A 28 1 ? 16 HELX_P HELX_P2 2 ASN A 42 ? GLY A 57 ? ASN A 42 GLY A 57 1 ? 16 HELX_P HELX_P3 3 THR A 76 ? GLU A 82 ? THR A 76 GLU A 82 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 2 C ? ? ? 1_555 A MSE 3 N ? ? A ALA 2 A MSE 3 1_555 ? ? ? ? ? ? ? 1.321 ? ? covale2 covale both ? A MSE 3 C ? ? ? 1_555 A LEU 4 N A ? A MSE 3 A LEU 4 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale3 covale both ? A MSE 3 C ? ? ? 1_555 A LEU 4 N B ? A MSE 3 A LEU 4 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale4 covale both ? A PHE 37 C ? ? ? 1_555 A MSE 38 N ? ? A PHE 37 A MSE 38 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale5 covale both ? A MSE 38 C ? ? ? 1_555 A GLY 39 N ? ? A MSE 38 A GLY 39 1_555 ? ? ? ? ? ? ? 1.325 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 30 ? GLN A 33 ? ASP A 30 GLN A 33 A 2 VAL A 36 ? LEU A 41 ? VAL A 36 LEU A 41 A 3 MSE A 3 ? ILE A 11 ? MSE A 3 ILE A 11 A 4 PHE A 68 ? ILE A 75 ? PHE A 68 ILE A 75 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASP A 30 ? N ASP A 30 O MSE A 38 ? O MSE A 38 A 2 3 O PHE A 37 ? O PHE A 37 N ILE A 7 ? N ILE A 7 A 3 4 N PHE A 8 ? N PHE A 8 O LEU A 71 ? O LEU A 71 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A IOD 102 ? 1 'BINDING SITE FOR RESIDUE IOD A 102' AC2 Software A IOD 103 ? 2 'BINDING SITE FOR RESIDUE IOD A 103' AC3 Software A IOD 104 ? 2 'BINDING SITE FOR RESIDUE IOD A 104' AC4 Software A IOD 105 ? 3 'BINDING SITE FOR RESIDUE IOD A 105' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 ARG A 19 ? ARG A 19 . ? 1_555 ? 2 AC2 2 SER A 44 ? SER A 44 . ? 1_555 ? 3 AC2 2 ARG A 83 ? ARG A 83 . ? 2_654 ? 4 AC3 2 LYS A 61 ? LYS A 61 . ? 1_555 ? 5 AC3 2 HOH F . ? HOH A 175 . ? 1_555 ? 6 AC4 3 LYS A 27 ? LYS A 27 . ? 1_555 ? 7 AC4 3 TYR A 34 ? TYR A 34 . ? 2_654 ? 8 AC4 3 ARG A 45 ? ARG A 45 . ? 1_555 ? # _database_PDB_matrix.entry_id 2I8E _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2I8E _atom_sites.fract_transf_matrix[1][1] 0.015558 _atom_sites.fract_transf_matrix[1][2] 0.008982 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017964 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.025298 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C I N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 MSE 3 3 3 MSE MSE A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 MSE 38 38 38 MSE MSE A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLY 90 90 ? ? ? A . n A 1 91 SER 91 91 ? ? ? A . n A 1 92 GLU 92 92 ? ? ? A . n A 1 93 ARG 93 93 ? ? ? A . n A 1 94 GLU 94 94 ? ? ? A . n A 1 95 GLU 95 95 ? ? ? A . n A 1 96 LYS 96 96 ? ? ? A . n A 1 97 SER 97 97 ? ? ? A . n A 1 98 ASN 98 98 ? ? ? A . n A 1 99 VAL 99 99 ? ? ? A . n A 1 100 VAL 100 100 ? ? ? A . n A 1 101 TRP 101 101 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IOD 1 102 1 IOD IOD A . C 2 IOD 1 103 2 IOD IOD A . D 2 IOD 1 104 3 IOD IOD A . E 2 IOD 1 105 4 IOD IOD A . F 3 HOH 1 106 1 HOH HOH A . F 3 HOH 2 107 2 HOH HOH A . F 3 HOH 3 108 3 HOH HOH A . F 3 HOH 4 109 4 HOH HOH A . F 3 HOH 5 110 5 HOH HOH A . F 3 HOH 6 111 6 HOH HOH A . F 3 HOH 7 112 7 HOH HOH A . F 3 HOH 8 113 8 HOH HOH A . F 3 HOH 9 114 9 HOH HOH A . F 3 HOH 10 115 10 HOH HOH A . F 3 HOH 11 116 11 HOH HOH A . F 3 HOH 12 117 12 HOH HOH A . F 3 HOH 13 118 13 HOH HOH A . F 3 HOH 14 119 14 HOH HOH A . F 3 HOH 15 120 15 HOH HOH A . F 3 HOH 16 121 16 HOH HOH A . F 3 HOH 17 122 17 HOH HOH A . F 3 HOH 18 123 18 HOH HOH A . F 3 HOH 19 124 19 HOH HOH A . F 3 HOH 20 125 20 HOH HOH A . F 3 HOH 21 126 21 HOH HOH A . F 3 HOH 22 127 22 HOH HOH A . F 3 HOH 23 128 23 HOH HOH A . F 3 HOH 24 129 24 HOH HOH A . F 3 HOH 25 130 25 HOH HOH A . F 3 HOH 26 131 26 HOH HOH A . F 3 HOH 27 132 27 HOH HOH A . F 3 HOH 28 133 28 HOH HOH A . F 3 HOH 29 134 29 HOH HOH A . F 3 HOH 30 135 30 HOH HOH A . F 3 HOH 31 136 31 HOH HOH A . F 3 HOH 32 137 32 HOH HOH A . F 3 HOH 33 138 33 HOH HOH A . F 3 HOH 34 139 34 HOH HOH A . F 3 HOH 35 140 35 HOH HOH A . F 3 HOH 36 141 36 HOH HOH A . F 3 HOH 37 142 37 HOH HOH A . F 3 HOH 38 143 38 HOH HOH A . F 3 HOH 39 144 39 HOH HOH A . F 3 HOH 40 145 40 HOH HOH A . F 3 HOH 41 146 41 HOH HOH A . F 3 HOH 42 147 42 HOH HOH A . F 3 HOH 43 148 43 HOH HOH A . F 3 HOH 44 149 44 HOH HOH A . F 3 HOH 45 150 45 HOH HOH A . F 3 HOH 46 151 46 HOH HOH A . F 3 HOH 47 152 47 HOH HOH A . F 3 HOH 48 153 48 HOH HOH A . F 3 HOH 49 154 49 HOH HOH A . F 3 HOH 50 155 50 HOH HOH A . F 3 HOH 51 156 51 HOH HOH A . F 3 HOH 52 157 52 HOH HOH A . F 3 HOH 53 158 53 HOH HOH A . F 3 HOH 54 159 54 HOH HOH A . F 3 HOH 55 160 55 HOH HOH A . F 3 HOH 56 161 56 HOH HOH A . F 3 HOH 57 162 57 HOH HOH A . F 3 HOH 58 163 58 HOH HOH A . F 3 HOH 59 164 59 HOH HOH A . F 3 HOH 60 165 60 HOH HOH A . F 3 HOH 61 166 61 HOH HOH A . F 3 HOH 62 167 62 HOH HOH A . F 3 HOH 63 168 63 HOH HOH A . F 3 HOH 64 169 64 HOH HOH A . F 3 HOH 65 170 65 HOH HOH A . F 3 HOH 66 171 66 HOH HOH A . F 3 HOH 67 172 67 HOH HOH A . F 3 HOH 68 173 68 HOH HOH A . F 3 HOH 69 174 69 HOH HOH A . F 3 HOH 70 175 70 HOH HOH A . F 3 HOH 71 176 71 HOH HOH A . F 3 HOH 72 177 72 HOH HOH A . F 3 HOH 73 178 73 HOH HOH A . F 3 HOH 74 179 74 HOH HOH A . F 3 HOH 75 180 75 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 3 A MSE 3 ? MET SELENOMETHIONINE 2 A MSE 38 A MSE 38 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4570 ? 1 MORE -31 ? 1 'SSA (A^2)' 9720 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_765 -x+2,-y+1,z -1.0000000000 0.0000000000 0.0000000000 96.4155000000 0.0000000000 -1.0000000000 0.0000000000 55.6655148791 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id PHE _pdbx_struct_special_symmetry.auth_seq_id 8 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id A _pdbx_struct_special_symmetry.label_comp_id PHE _pdbx_struct_special_symmetry.label_seq_id 8 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-09-26 2 'Structure model' 1 1 2007-10-16 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-04-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Source and taxonomy' 5 3 'Structure model' 'Version format compliance' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' audit_author 2 4 'Structure model' citation_author 3 4 'Structure model' database_2 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_audit_author.identifier_ORCID' 2 4 'Structure model' '_citation_author.identifier_ORCID' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.pdbx_refine_id 1 ? refined 40.0383 29.0656 21.1118 -0.0427 -0.0501 -0.0614 -0.0206 -0.0032 0.0017 2.8524 1.9315 2.5946 0.7170 0.8084 1.1739 0.0195 -0.1189 0.0285 0.1756 -0.0783 0.0298 -0.0500 -0.0288 0.0587 'X-RAY DIFFRACTION' 2 ? refined 32.5477 24.9387 18.6142 -0.0545 -0.0053 -0.0301 -0.0259 -0.0157 0.0160 5.1362 2.8579 6.0271 0.5067 -1.8223 2.1442 -0.0250 0.1904 -0.1836 0.0695 -0.0346 0.2546 0.0691 -0.4294 0.0596 'X-RAY DIFFRACTION' 3 ? refined 37.6575 25.3248 13.8866 -0.0769 -0.0233 -0.0554 -0.0158 -0.0027 0.0003 4.2336 3.2354 6.2488 -1.8644 3.7059 -2.8088 0.0802 0.2398 -0.0898 -0.0380 -0.0812 0.0987 0.0324 0.1281 0.0009 'X-RAY DIFFRACTION' 4 ? refined 32.9726 36.7851 18.4578 -0.0019 -0.0128 -0.0219 0.0096 0.0022 -0.0032 2.5881 1.9848 13.1211 -0.2632 -0.2203 4.0556 -0.0283 -0.1222 0.3808 -0.0030 -0.1200 0.0572 -0.2025 -0.2107 0.1484 'X-RAY DIFFRACTION' 5 ? refined 43.7252 36.3920 24.5366 -0.0217 0.0080 -0.0253 -0.0106 -0.0076 -0.0125 1.3745 1.4895 5.3759 1.2514 2.6353 2.0629 0.0798 -0.1166 0.1535 0.0472 -0.0971 -0.0315 -0.0923 -0.1552 0.0174 'X-RAY DIFFRACTION' 6 ? refined 50.9626 18.4337 10.7894 0.0187 -0.0198 -0.0169 0.0155 -0.0043 -0.0397 5.2431 3.3656 13.8664 -2.2852 7.0256 -4.3247 0.0410 0.1135 -0.4209 0.0289 0.0464 0.0861 0.2813 -0.0548 -0.0874 'X-RAY DIFFRACTION' # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.selection_details 1 1 A 2 2 A 19 19 ? A A 'X-RAY DIFFRACTION' ? 2 2 A 20 20 A 30 30 ? A A 'X-RAY DIFFRACTION' ? 3 3 A 31 31 A 46 46 ? A A 'X-RAY DIFFRACTION' ? 4 4 A 47 47 A 58 58 ? A A 'X-RAY DIFFRACTION' ? 5 5 A 59 59 A 75 75 ? A A 'X-RAY DIFFRACTION' ? 6 6 A 76 76 A 89 89 ? A A 'X-RAY DIFFRACTION' ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0005 ? 1 HKL-3000 'data collection' . ? 2 HKL-3000 'data reduction' . ? 3 HKL-3000 'data scaling' . ? 4 HKL-3000 phasing . ? 5 SHELXD phasing . ? 6 SHELXE 'model building' . ? 7 MLPHARE phasing . ? 8 DM phasing . ? 9 ARP/wARP 'model building' . ? 10 RESOLVE phasing . ? 11 CCP4 phasing . ? 12 O 'model building' . ? 13 Coot 'model building' . ? 14 # _pdbx_database_remark.id 300 _pdbx_database_remark.text ; BIOMOLECULE: 1 THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT WHICH CONSISTS OF 1 CHAIN(S). SEE REMARK 350 FOR INFORMATION ON GENERATING THE BIOLOGICAL MOLECULE(S). THE AUTHORS STATE, HOWEVER, THAT THIS BIOLOGICAL ASSEMBLY HAS NOT BEEN EXPERIMENTALLY GENERATED. ; # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 22 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 173 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OE1 A GLU 82 ? B 1_555 O A HOH 117 ? ? 4_765 1.86 2 1 OE2 A GLU 66 ? ? 1_555 OH A TYR 88 ? ? 4_765 2.10 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 125.67 120.30 5.37 0.50 N 2 1 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH2 A ARG 17 ? ? 115.62 120.30 -4.68 0.50 N # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 47 ? CD ? A LYS 47 CD 2 1 Y 1 A LYS 47 ? CE ? A LYS 47 CE 3 1 Y 1 A LYS 47 ? NZ ? A LYS 47 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A GLY 90 ? A GLY 90 3 1 Y 1 A SER 91 ? A SER 91 4 1 Y 1 A GLU 92 ? A GLU 92 5 1 Y 1 A ARG 93 ? A ARG 93 6 1 Y 1 A GLU 94 ? A GLU 94 7 1 Y 1 A GLU 95 ? A GLU 95 8 1 Y 1 A LYS 96 ? A LYS 96 9 1 Y 1 A SER 97 ? A SER 97 10 1 Y 1 A ASN 98 ? A ASN 98 11 1 Y 1 A VAL 99 ? A VAL 99 12 1 Y 1 A VAL 100 ? A VAL 100 13 1 Y 1 A TRP 101 ? A TRP 101 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'IODIDE ION' IOD 3 water HOH #