data_2IMG # _entry.id 2IMG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.338 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2IMG RCSB RCSB039750 WWPDB D_1000039750 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id NYSGXRC-8673a _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2IMG _pdbx_database_status.recvd_initial_deposition_date 2006-10-04 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Agarwal, R.' 1 ? 'Burley, S.K.' 2 0000-0002-2487-9713 'Swaminathan, S.' 3 ? 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 4 ? # _citation.id primary _citation.title 'Structure of human dual specificity protein phosphatase 23, VHZ, enzyme-substrate/product complex.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 283 _citation.page_first 8946 _citation.page_last 8953 _citation.year 2008 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18245086 _citation.pdbx_database_id_DOI 10.1074/jbc.M708945200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Agarwal, R.' 1 ? primary 'Burley, S.K.' 2 0000-0002-2487-9713 primary 'Swaminathan, S.' 3 ? # _cell.entry_id 2IMG _cell.length_a 35.970 _cell.length_b 59.253 _cell.length_c 64.400 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2IMG _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dual specificity protein phosphatase 23' 16726.074 1 '3.1.3.48, 3.1.3.16' ? ? ? 2 non-polymer syn D-MALATE 134.087 1 ? ? ? ? 3 water nat water 18.015 114 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Low molecular mass dual specificity phosphatase 3, LDP-3, VH1-like phosphatase Z' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SLGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQ IVDEANARGEAVGVHCALGFGRTGT(MSE)LACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK ; _entity_poly.pdbx_seq_one_letter_code_can ;SLGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQ IVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGXRC-8673a # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LEU n 1 3 GLY n 1 4 VAL n 1 5 GLN n 1 6 PRO n 1 7 PRO n 1 8 ASN n 1 9 PHE n 1 10 SER n 1 11 TRP n 1 12 VAL n 1 13 LEU n 1 14 PRO n 1 15 GLY n 1 16 ARG n 1 17 LEU n 1 18 ALA n 1 19 GLY n 1 20 LEU n 1 21 ALA n 1 22 LEU n 1 23 PRO n 1 24 ARG n 1 25 LEU n 1 26 PRO n 1 27 ALA n 1 28 HIS n 1 29 TYR n 1 30 GLN n 1 31 PHE n 1 32 LEU n 1 33 LEU n 1 34 ASP n 1 35 LEU n 1 36 GLY n 1 37 VAL n 1 38 ARG n 1 39 HIS n 1 40 LEU n 1 41 VAL n 1 42 SER n 1 43 LEU n 1 44 THR n 1 45 GLU n 1 46 ARG n 1 47 GLY n 1 48 PRO n 1 49 PRO n 1 50 HIS n 1 51 SER n 1 52 ASP n 1 53 SER n 1 54 CYS n 1 55 PRO n 1 56 GLY n 1 57 LEU n 1 58 THR n 1 59 LEU n 1 60 HIS n 1 61 ARG n 1 62 LEU n 1 63 ARG n 1 64 ILE n 1 65 PRO n 1 66 ASP n 1 67 PHE n 1 68 CYS n 1 69 PRO n 1 70 PRO n 1 71 ALA n 1 72 PRO n 1 73 ASP n 1 74 GLN n 1 75 ILE n 1 76 ASP n 1 77 ARG n 1 78 PHE n 1 79 VAL n 1 80 GLN n 1 81 ILE n 1 82 VAL n 1 83 ASP n 1 84 GLU n 1 85 ALA n 1 86 ASN n 1 87 ALA n 1 88 ARG n 1 89 GLY n 1 90 GLU n 1 91 ALA n 1 92 VAL n 1 93 GLY n 1 94 VAL n 1 95 HIS n 1 96 CYS n 1 97 ALA n 1 98 LEU n 1 99 GLY n 1 100 PHE n 1 101 GLY n 1 102 ARG n 1 103 THR n 1 104 GLY n 1 105 THR n 1 106 MSE n 1 107 LEU n 1 108 ALA n 1 109 CYS n 1 110 TYR n 1 111 LEU n 1 112 VAL n 1 113 LYS n 1 114 GLU n 1 115 ARG n 1 116 GLY n 1 117 LEU n 1 118 ALA n 1 119 ALA n 1 120 GLY n 1 121 ASP n 1 122 ALA n 1 123 ILE n 1 124 ALA n 1 125 GLU n 1 126 ILE n 1 127 ARG n 1 128 ARG n 1 129 LEU n 1 130 ARG n 1 131 PRO n 1 132 GLY n 1 133 SER n 1 134 ILE n 1 135 GLU n 1 136 THR n 1 137 TYR n 1 138 GLU n 1 139 GLN n 1 140 GLU n 1 141 LYS n 1 142 ALA n 1 143 VAL n 1 144 PHE n 1 145 GLN n 1 146 PHE n 1 147 TYR n 1 148 GLN n 1 149 ARG n 1 150 THR n 1 151 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene DUSP23 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pSGX4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DUS23_HUMAN _struct_ref.pdbx_db_accession Q9BVJ7 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2IMG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 151 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9BVJ7 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 150 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 150 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2IMG SER A 1 ? UNP Q9BVJ7 ? ? 'cloning artifact' 0 1 1 2IMG LEU A 2 ? UNP Q9BVJ7 ? ? 'cloning artifact' 1 2 1 2IMG MSE A 106 ? UNP Q9BVJ7 MET 105 'modified residue' 105 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MLT non-polymer . D-MALATE '(2R)-2-HYDROXYBUTANEDIOIC ACID; 2-HYDROXY-SUCCINIC ACID' 'C4 H6 O5' 134.087 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2IMG _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 2 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.05 _exptl_crystal.density_percent_sol 40.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details '0.1M DL Malic acid, 20% PEG 3350, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2006-09-22 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si (111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9791 # _reflns.entry_id 2IMG _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 1.93 _reflns.number_obs 10874 _reflns.number_all 10874 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.09 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 9.5 _reflns.B_iso_Wilson_estimate 11.3 _reflns.pdbx_redundancy 33.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.93 _reflns_shell.d_res_low 2.00 _reflns_shell.percent_possible_all 99.3 _reflns_shell.Rmerge_I_obs 0.25 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 4 _reflns_shell.pdbx_redundancy 19 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1058 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2IMG _refine.ls_number_reflns_obs 10835 _refine.ls_number_reflns_all 10835 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 96730.07 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 31.40 _refine.ls_d_res_high 1.93 _refine.ls_percent_reflns_obs 98.6 _refine.ls_R_factor_obs 0.195 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.195 _refine.ls_R_factor_R_free 0.229 _refine.ls_R_factor_R_free_error 0.010 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 2.9 _refine.ls_number_reflns_R_free 324 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 18.8 _refine.aniso_B[1][1] -1.98 _refine.aniso_B[2][2] 6.74 _refine.aniso_B[3][3] -4.76 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.34178 _refine.solvent_model_param_bsol 36.5848 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'the missing residues listed in Remark 465 are due to lack of electron density.' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2IMG _refine_analyze.Luzzati_coordinate_error_obs 0.21 _refine_analyze.Luzzati_sigma_a_obs 0.09 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.27 _refine_analyze.Luzzati_sigma_a_free 0.12 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1161 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 114 _refine_hist.number_atoms_total 1284 _refine_hist.d_res_high 1.93 _refine_hist.d_res_low 31.40 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 22.2 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.83 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.93 _refine_ls_shell.d_res_low 2.05 _refine_ls_shell.number_reflns_R_work 3071 _refine_ls_shell.R_factor_R_work 0.205 _refine_ls_shell.percent_reflns_obs 95.2 _refine_ls_shell.R_factor_R_free 0.272 _refine_ls_shell.R_factor_R_free_error 0.028 _refine_ls_shell.percent_reflns_R_free 3.0 _refine_ls_shell.number_reflns_R_free 96 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 ion.param mlt-new.top 'X-RAY DIFFRACTION' 3 water_rep.param ? 'X-RAY DIFFRACTION' 4 mlt-new.param ? 'X-RAY DIFFRACTION' # _struct.entry_id 2IMG _struct.title 'Crystal structure of dual specificity protein phosphatase 23 from Homo sapiens in complex with ligand malate ion' _struct.pdbx_descriptor 'Dual specificity protein phosphatase 23 (E.C.3.1.3.48, 3.1.3.16)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2IMG _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, dus23_human, malate, 8673a, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 25 ? LEU A 35 ? LEU A 24 LEU A 34 1 ? 11 HELX_P HELX_P2 2 HIS A 50 ? CYS A 54 ? HIS A 49 CYS A 53 5 ? 5 HELX_P HELX_P3 3 ALA A 71 ? ARG A 88 ? ALA A 70 ARG A 87 1 ? 18 HELX_P HELX_P4 4 GLY A 101 ? GLY A 116 ? GLY A 100 GLY A 115 1 ? 16 HELX_P HELX_P5 5 ALA A 118 ? ARG A 130 ? ALA A 117 ARG A 129 1 ? 13 HELX_P HELX_P6 6 THR A 136 ? ARG A 149 ? THR A 135 ARG A 148 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A THR 105 C ? ? ? 1_555 A MSE 106 N ? ? A THR 104 A MSE 105 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale both ? A MSE 106 C ? ? ? 1_555 A LEU 107 N ? ? A MSE 105 A LEU 106 1_555 ? ? ? ? ? ? ? 1.324 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 10 ? LEU A 13 ? SER A 9 LEU A 12 A 2 LEU A 17 ? LEU A 20 ? LEU A 16 LEU A 19 A 3 ALA A 91 ? HIS A 95 ? ALA A 90 HIS A 94 A 4 VAL A 37 ? SER A 42 ? VAL A 36 SER A 41 A 5 THR A 58 ? ARG A 61 ? THR A 57 ARG A 60 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 12 ? N VAL A 11 O LEU A 17 ? O LEU A 16 A 2 3 N ALA A 18 ? N ALA A 17 O VAL A 94 ? O VAL A 93 A 3 4 O GLY A 93 ? O GLY A 92 N VAL A 41 ? N VAL A 40 A 4 5 N LEU A 40 ? N LEU A 39 O HIS A 60 ? O HIS A 59 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id MLT _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'BINDING SITE FOR RESIDUE MLT A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 PHE A 67 ? PHE A 66 . ? 1_555 ? 2 AC1 11 CYS A 96 ? CYS A 95 . ? 1_555 ? 3 AC1 11 ALA A 97 ? ALA A 96 . ? 1_555 ? 4 AC1 11 LEU A 98 ? LEU A 97 . ? 1_555 ? 5 AC1 11 GLY A 99 ? GLY A 98 . ? 1_555 ? 6 AC1 11 PHE A 100 ? PHE A 99 . ? 1_555 ? 7 AC1 11 GLY A 101 ? GLY A 100 . ? 1_555 ? 8 AC1 11 ARG A 102 ? ARG A 101 . ? 1_555 ? 9 AC1 11 TYR A 137 ? TYR A 136 . ? 4_555 ? 10 AC1 11 LYS A 141 ? LYS A 140 . ? 4_555 ? 11 AC1 11 HOH C . ? HOH A 519 . ? 1_555 ? # _database_PDB_matrix.entry_id 2IMG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2IMG _atom_sites.fract_transf_matrix[1][1] 0.027801 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016877 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015528 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 0 ? ? ? A . n A 1 2 LEU 2 1 ? ? ? A . n A 1 3 GLY 3 2 2 GLY GLY A . n A 1 4 VAL 4 3 3 VAL VAL A . n A 1 5 GLN 5 4 4 GLN GLN A . n A 1 6 PRO 6 5 5 PRO PRO A . n A 1 7 PRO 7 6 6 PRO PRO A . n A 1 8 ASN 8 7 7 ASN ASN A . n A 1 9 PHE 9 8 8 PHE PHE A . n A 1 10 SER 10 9 9 SER SER A . n A 1 11 TRP 11 10 10 TRP TRP A . n A 1 12 VAL 12 11 11 VAL VAL A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 PRO 14 13 13 PRO PRO A . n A 1 15 GLY 15 14 14 GLY GLY A . n A 1 16 ARG 16 15 15 ARG ARG A . n A 1 17 LEU 17 16 16 LEU LEU A . n A 1 18 ALA 18 17 17 ALA ALA A . n A 1 19 GLY 19 18 18 GLY GLY A . n A 1 20 LEU 20 19 19 LEU LEU A . n A 1 21 ALA 21 20 20 ALA ALA A . n A 1 22 LEU 22 21 21 LEU LEU A . n A 1 23 PRO 23 22 22 PRO PRO A . n A 1 24 ARG 24 23 23 ARG ARG A . n A 1 25 LEU 25 24 24 LEU LEU A . n A 1 26 PRO 26 25 25 PRO PRO A . n A 1 27 ALA 27 26 26 ALA ALA A . n A 1 28 HIS 28 27 27 HIS HIS A . n A 1 29 TYR 29 28 28 TYR TYR A . n A 1 30 GLN 30 29 29 GLN GLN A . n A 1 31 PHE 31 30 30 PHE PHE A . n A 1 32 LEU 32 31 31 LEU LEU A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 ASP 34 33 33 ASP ASP A . n A 1 35 LEU 35 34 34 LEU LEU A . n A 1 36 GLY 36 35 35 GLY GLY A . n A 1 37 VAL 37 36 36 VAL VAL A . n A 1 38 ARG 38 37 37 ARG ARG A . n A 1 39 HIS 39 38 38 HIS HIS A . n A 1 40 LEU 40 39 39 LEU LEU A . n A 1 41 VAL 41 40 40 VAL VAL A . n A 1 42 SER 42 41 41 SER SER A . n A 1 43 LEU 43 42 42 LEU LEU A . n A 1 44 THR 44 43 43 THR THR A . n A 1 45 GLU 45 44 44 GLU GLU A . n A 1 46 ARG 46 45 45 ARG ARG A . n A 1 47 GLY 47 46 46 GLY GLY A . n A 1 48 PRO 48 47 47 PRO PRO A . n A 1 49 PRO 49 48 48 PRO PRO A . n A 1 50 HIS 50 49 49 HIS HIS A . n A 1 51 SER 51 50 50 SER SER A . n A 1 52 ASP 52 51 51 ASP ASP A . n A 1 53 SER 53 52 52 SER SER A . n A 1 54 CYS 54 53 53 CYS CYS A . n A 1 55 PRO 55 54 54 PRO PRO A . n A 1 56 GLY 56 55 55 GLY GLY A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 THR 58 57 57 THR THR A . n A 1 59 LEU 59 58 58 LEU LEU A . n A 1 60 HIS 60 59 59 HIS HIS A . n A 1 61 ARG 61 60 60 ARG ARG A . n A 1 62 LEU 62 61 61 LEU LEU A . n A 1 63 ARG 63 62 62 ARG ARG A . n A 1 64 ILE 64 63 63 ILE ILE A . n A 1 65 PRO 65 64 64 PRO PRO A . n A 1 66 ASP 66 65 65 ASP ASP A . n A 1 67 PHE 67 66 66 PHE PHE A . n A 1 68 CYS 68 67 67 CYS CYS A . n A 1 69 PRO 69 68 68 PRO PRO A . n A 1 70 PRO 70 69 69 PRO PRO A . n A 1 71 ALA 71 70 70 ALA ALA A . n A 1 72 PRO 72 71 71 PRO PRO A . n A 1 73 ASP 73 72 72 ASP ASP A . n A 1 74 GLN 74 73 73 GLN GLN A . n A 1 75 ILE 75 74 74 ILE ILE A . n A 1 76 ASP 76 75 75 ASP ASP A . n A 1 77 ARG 77 76 76 ARG ARG A . n A 1 78 PHE 78 77 77 PHE PHE A . n A 1 79 VAL 79 78 78 VAL VAL A . n A 1 80 GLN 80 79 79 GLN GLN A . n A 1 81 ILE 81 80 80 ILE ILE A . n A 1 82 VAL 82 81 81 VAL VAL A . n A 1 83 ASP 83 82 82 ASP ASP A . n A 1 84 GLU 84 83 83 GLU GLU A . n A 1 85 ALA 85 84 84 ALA ALA A . n A 1 86 ASN 86 85 85 ASN ASN A . n A 1 87 ALA 87 86 86 ALA ALA A . n A 1 88 ARG 88 87 87 ARG ARG A . n A 1 89 GLY 89 88 88 GLY GLY A . n A 1 90 GLU 90 89 89 GLU GLU A . n A 1 91 ALA 91 90 90 ALA ALA A . n A 1 92 VAL 92 91 91 VAL VAL A . n A 1 93 GLY 93 92 92 GLY GLY A . n A 1 94 VAL 94 93 93 VAL VAL A . n A 1 95 HIS 95 94 94 HIS HIS A . n A 1 96 CYS 96 95 95 CYS CYS A . n A 1 97 ALA 97 96 96 ALA ALA A . n A 1 98 LEU 98 97 97 LEU LEU A . n A 1 99 GLY 99 98 98 GLY GLY A . n A 1 100 PHE 100 99 99 PHE PHE A . n A 1 101 GLY 101 100 100 GLY GLY A . n A 1 102 ARG 102 101 101 ARG ARG A . n A 1 103 THR 103 102 102 THR THR A . n A 1 104 GLY 104 103 103 GLY GLY A . n A 1 105 THR 105 104 104 THR THR A . n A 1 106 MSE 106 105 105 MSE MSE A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 ALA 108 107 107 ALA ALA A . n A 1 109 CYS 109 108 108 CYS CYS A . n A 1 110 TYR 110 109 109 TYR TYR A . n A 1 111 LEU 111 110 110 LEU LEU A . n A 1 112 VAL 112 111 111 VAL VAL A . n A 1 113 LYS 113 112 112 LYS LYS A . n A 1 114 GLU 114 113 113 GLU GLU A . n A 1 115 ARG 115 114 114 ARG ARG A . n A 1 116 GLY 116 115 115 GLY GLY A . n A 1 117 LEU 117 116 116 LEU LEU A . n A 1 118 ALA 118 117 117 ALA ALA A . n A 1 119 ALA 119 118 118 ALA ALA A . n A 1 120 GLY 120 119 119 GLY GLY A . n A 1 121 ASP 121 120 120 ASP ASP A . n A 1 122 ALA 122 121 121 ALA ALA A . n A 1 123 ILE 123 122 122 ILE ILE A . n A 1 124 ALA 124 123 123 ALA ALA A . n A 1 125 GLU 125 124 124 GLU GLU A . n A 1 126 ILE 126 125 125 ILE ILE A . n A 1 127 ARG 127 126 126 ARG ARG A . n A 1 128 ARG 128 127 127 ARG ARG A . n A 1 129 LEU 129 128 128 LEU LEU A . n A 1 130 ARG 130 129 129 ARG ARG A . n A 1 131 PRO 131 130 130 PRO PRO A . n A 1 132 GLY 132 131 131 GLY GLY A . n A 1 133 SER 133 132 132 SER SER A . n A 1 134 ILE 134 133 133 ILE ILE A . n A 1 135 GLU 135 134 134 GLU GLU A . n A 1 136 THR 136 135 135 THR THR A . n A 1 137 TYR 137 136 136 TYR TYR A . n A 1 138 GLU 138 137 137 GLU GLU A . n A 1 139 GLN 139 138 138 GLN GLN A . n A 1 140 GLU 140 139 139 GLU GLU A . n A 1 141 LYS 141 140 140 LYS LYS A . n A 1 142 ALA 142 141 141 ALA ALA A . n A 1 143 VAL 143 142 142 VAL VAL A . n A 1 144 PHE 144 143 143 PHE PHE A . n A 1 145 GLN 145 144 144 GLN GLN A . n A 1 146 PHE 146 145 145 PHE PHE A . n A 1 147 TYR 147 146 146 TYR TYR A . n A 1 148 GLN 148 147 147 GLN GLN A . n A 1 149 ARG 149 148 148 ARG ARG A . n A 1 150 THR 150 149 149 THR THR A . n A 1 151 LYS 151 150 150 LYS LYS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'New York SGX Research Center for Structural Genomics' _pdbx_SG_project.initial_of_center NYSGXRC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MLT 1 501 501 MLT MLT A . C 3 HOH 1 502 1 HOH HOH A . C 3 HOH 2 503 2 HOH HOH A . C 3 HOH 3 504 3 HOH HOH A . C 3 HOH 4 505 4 HOH HOH A . C 3 HOH 5 506 5 HOH HOH A . C 3 HOH 6 507 8 HOH HOH A . C 3 HOH 7 508 9 HOH HOH A . C 3 HOH 8 509 11 HOH HOH A . C 3 HOH 9 510 12 HOH HOH A . C 3 HOH 10 511 13 HOH HOH A . C 3 HOH 11 512 14 HOH HOH A . C 3 HOH 12 513 15 HOH HOH A . C 3 HOH 13 514 16 HOH HOH A . C 3 HOH 14 515 17 HOH HOH A . C 3 HOH 15 516 18 HOH HOH A . C 3 HOH 16 517 19 HOH HOH A . C 3 HOH 17 518 21 HOH HOH A . C 3 HOH 18 519 22 HOH HOH A . C 3 HOH 19 520 23 HOH HOH A . C 3 HOH 20 521 24 HOH HOH A . C 3 HOH 21 522 25 HOH HOH A . C 3 HOH 22 523 26 HOH HOH A . C 3 HOH 23 524 27 HOH HOH A . C 3 HOH 24 525 28 HOH HOH A . C 3 HOH 25 526 29 HOH HOH A . C 3 HOH 26 527 30 HOH HOH A . C 3 HOH 27 528 31 HOH HOH A . C 3 HOH 28 529 32 HOH HOH A . C 3 HOH 29 530 33 HOH HOH A . C 3 HOH 30 531 34 HOH HOH A . C 3 HOH 31 532 35 HOH HOH A . C 3 HOH 32 533 36 HOH HOH A . C 3 HOH 33 534 37 HOH HOH A . C 3 HOH 34 535 39 HOH HOH A . C 3 HOH 35 536 40 HOH HOH A . C 3 HOH 36 537 41 HOH HOH A . C 3 HOH 37 538 42 HOH HOH A . C 3 HOH 38 539 43 HOH HOH A . C 3 HOH 39 540 44 HOH HOH A . C 3 HOH 40 541 45 HOH HOH A . C 3 HOH 41 542 46 HOH HOH A . C 3 HOH 42 543 47 HOH HOH A . C 3 HOH 43 544 48 HOH HOH A . C 3 HOH 44 545 49 HOH HOH A . C 3 HOH 45 546 50 HOH HOH A . C 3 HOH 46 547 51 HOH HOH A . C 3 HOH 47 548 56 HOH HOH A . C 3 HOH 48 549 57 HOH HOH A . C 3 HOH 49 550 58 HOH HOH A . C 3 HOH 50 551 59 HOH HOH A . C 3 HOH 51 552 60 HOH HOH A . C 3 HOH 52 553 61 HOH HOH A . C 3 HOH 53 554 62 HOH HOH A . C 3 HOH 54 555 63 HOH HOH A . C 3 HOH 55 556 66 HOH HOH A . C 3 HOH 56 557 67 HOH HOH A . C 3 HOH 57 558 68 HOH HOH A . C 3 HOH 58 559 69 HOH HOH A . C 3 HOH 59 560 70 HOH HOH A . C 3 HOH 60 561 71 HOH HOH A . C 3 HOH 61 562 72 HOH HOH A . C 3 HOH 62 563 73 HOH HOH A . C 3 HOH 63 564 74 HOH HOH A . C 3 HOH 64 565 75 HOH HOH A . C 3 HOH 65 566 77 HOH HOH A . C 3 HOH 66 567 78 HOH HOH A . C 3 HOH 67 568 80 HOH HOH A . C 3 HOH 68 569 81 HOH HOH A . C 3 HOH 69 570 82 HOH HOH A . C 3 HOH 70 571 83 HOH HOH A . C 3 HOH 71 572 84 HOH HOH A . C 3 HOH 72 573 85 HOH HOH A . C 3 HOH 73 574 86 HOH HOH A . C 3 HOH 74 575 87 HOH HOH A . C 3 HOH 75 576 88 HOH HOH A . C 3 HOH 76 577 89 HOH HOH A . C 3 HOH 77 578 90 HOH HOH A . C 3 HOH 78 579 91 HOH HOH A . C 3 HOH 79 580 94 HOH HOH A . C 3 HOH 80 581 95 HOH HOH A . C 3 HOH 81 582 104 HOH HOH A . C 3 HOH 82 583 105 HOH HOH A . C 3 HOH 83 584 106 HOH HOH A . C 3 HOH 84 585 108 HOH HOH A . C 3 HOH 85 586 110 HOH HOH A . C 3 HOH 86 587 111 HOH HOH A . C 3 HOH 87 588 116 HOH HOH A . C 3 HOH 88 589 117 HOH HOH A . C 3 HOH 89 590 122 HOH HOH A . C 3 HOH 90 591 123 HOH HOH A . C 3 HOH 91 592 124 HOH HOH A . C 3 HOH 92 593 126 HOH HOH A . C 3 HOH 93 594 128 HOH HOH A . C 3 HOH 94 595 130 HOH HOH A . C 3 HOH 95 596 131 HOH HOH A . C 3 HOH 96 597 134 HOH HOH A . C 3 HOH 97 598 144 HOH HOH A . C 3 HOH 98 599 146 HOH HOH A . C 3 HOH 99 600 151 HOH HOH A . C 3 HOH 100 601 154 HOH HOH A . C 3 HOH 101 602 156 HOH HOH A . C 3 HOH 102 603 158 HOH HOH A . C 3 HOH 103 604 160 HOH HOH A . C 3 HOH 104 605 161 HOH HOH A . C 3 HOH 105 606 162 HOH HOH A . C 3 HOH 106 607 163 HOH HOH A . C 3 HOH 107 608 164 HOH HOH A . C 3 HOH 108 609 166 HOH HOH A . C 3 HOH 109 610 173 HOH HOH A . C 3 HOH 110 611 177 HOH HOH A . C 3 HOH 111 612 178 HOH HOH A . C 3 HOH 112 613 179 HOH HOH A . C 3 HOH 113 614 180 HOH HOH A . C 3 HOH 114 615 181 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id MSE _pdbx_struct_mod_residue.label_seq_id 106 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id MSE _pdbx_struct_mod_residue.auth_seq_id 105 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id MET _pdbx_struct_mod_residue.details SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-17 2 'Structure model' 1 1 2008-03-20 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-02-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' audit_author 2 4 'Structure model' citation_author 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif 5 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_audit_author.identifier_ORCID' 2 4 'Structure model' '_citation_author.identifier_ORCID' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 CBASS 'data collection' . ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 SOLVE phasing . ? 5 SHARP phasing . ? 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 13 ? ? -38.58 117.16 2 1 ARG A 15 ? ? -133.20 -46.82 3 1 ARG A 23 ? ? -142.02 -1.94 4 1 CYS A 95 ? ? -137.59 -146.36 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id C2 _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id MLT _pdbx_validate_chiral.auth_seq_id 501 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 0 ? A SER 1 2 1 Y 1 A LEU 1 ? A LEU 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 D-MALATE MLT 3 water HOH #