data_2IT5 # _entry.id 2IT5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2IT5 RCSB RCSB039983 WWPDB D_1000039983 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2IT6 _pdbx_database_related.details 'Crystal Structure of DCSIGN-CRD with man2' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2IT5 _pdbx_database_status.recvd_initial_deposition_date 2006-10-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Weis, W.I.' 1 'Feinberg, H.' 2 'Castelli, R.' 3 'Drickamer, K.' 4 'Seeberger, P.H.' 5 # _citation.id primary _citation.title 'Multiple modes of binding enhance the affinity of DC-SIGN for high mannose N-linked glycans found on viral glycoproteins.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 282 _citation.page_first 4202 _citation.page_last 4209 _citation.year 2007 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17150970 _citation.pdbx_database_id_DOI 10.1074/jbc.M609689200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Feinberg, H.' 1 ? primary 'Castelli, R.' 2 ? primary 'Drickamer, K.' 3 ? primary 'Seeberger, P.H.' 4 ? primary 'Weis, W.I.' 5 ? # _cell.entry_id 2IT5 _cell.length_a 55.960 _cell.length_b 55.960 _cell.length_c 53.260 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2IT5 _symmetry.space_group_name_H-M 'P 43' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 78 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CD209 antigen, DCSIGN-CRD' 16130.791 1 ? ? ? ? 2 branched man 'alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose' 504.438 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 3 ? ? ? ? 4 water nat water 18.015 59 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Dendritic cell-specific ICAM-3-grabbing nonintegrin 1, DC-SIGN1, DC-SIGN, C-type lectin domain family 4 member L' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQW VDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDE ; _entity_poly.pdbx_seq_one_letter_code_can ;ERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQW VDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ARG n 1 3 LEU n 1 4 CYS n 1 5 HIS n 1 6 PRO n 1 7 CYS n 1 8 PRO n 1 9 TRP n 1 10 GLU n 1 11 TRP n 1 12 THR n 1 13 PHE n 1 14 PHE n 1 15 GLN n 1 16 GLY n 1 17 ASN n 1 18 CYS n 1 19 TYR n 1 20 PHE n 1 21 MET n 1 22 SER n 1 23 ASN n 1 24 SER n 1 25 GLN n 1 26 ARG n 1 27 ASN n 1 28 TRP n 1 29 HIS n 1 30 ASP n 1 31 SER n 1 32 ILE n 1 33 THR n 1 34 ALA n 1 35 CYS n 1 36 LYS n 1 37 GLU n 1 38 VAL n 1 39 GLY n 1 40 ALA n 1 41 GLN n 1 42 LEU n 1 43 VAL n 1 44 VAL n 1 45 ILE n 1 46 LYS n 1 47 SER n 1 48 ALA n 1 49 GLU n 1 50 GLU n 1 51 GLN n 1 52 ASN n 1 53 PHE n 1 54 LEU n 1 55 GLN n 1 56 LEU n 1 57 GLN n 1 58 SER n 1 59 SER n 1 60 ARG n 1 61 SER n 1 62 ASN n 1 63 ARG n 1 64 PHE n 1 65 THR n 1 66 TRP n 1 67 MET n 1 68 GLY n 1 69 LEU n 1 70 SER n 1 71 ASP n 1 72 LEU n 1 73 ASN n 1 74 GLN n 1 75 GLU n 1 76 GLY n 1 77 THR n 1 78 TRP n 1 79 GLN n 1 80 TRP n 1 81 VAL n 1 82 ASP n 1 83 GLY n 1 84 SER n 1 85 PRO n 1 86 LEU n 1 87 LEU n 1 88 PRO n 1 89 SER n 1 90 PHE n 1 91 LYS n 1 92 GLN n 1 93 TYR n 1 94 TRP n 1 95 ASN n 1 96 ARG n 1 97 GLY n 1 98 GLU n 1 99 PRO n 1 100 ASN n 1 101 ASN n 1 102 VAL n 1 103 GLY n 1 104 GLU n 1 105 GLU n 1 106 ASP n 1 107 CYS n 1 108 ALA n 1 109 GLU n 1 110 PHE n 1 111 SER n 1 112 GLY n 1 113 ASN n 1 114 GLY n 1 115 TRP n 1 116 ASN n 1 117 ASP n 1 118 ASP n 1 119 LYS n 1 120 CYS n 1 121 ASN n 1 122 LEU n 1 123 ALA n 1 124 LYS n 1 125 PHE n 1 126 TRP n 1 127 ILE n 1 128 CYS n 1 129 LYS n 1 130 LYS n 1 131 SER n 1 132 ALA n 1 133 ALA n 1 134 SER n 1 135 CYS n 1 136 SER n 1 137 ARG n 1 138 ASP n 1 139 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'CD209, CLEC4L' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CD209_HUMAN _struct_ref.pdbx_db_accession Q9NNX6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQW VDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDE ; _struct_ref.pdbx_align_begin 250 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2IT5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 139 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NNX6 _struct_ref_seq.db_align_beg 250 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 388 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 250 _struct_ref_seq.pdbx_auth_seq_align_end 388 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose ? 'C6 H12 O6' 180.156 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2IT5 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_percent_sol 52.40 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details ;protein solution contained 5 mg ml-1 protein, 5 mM CaCl2, 50 mM Man6, reservoir solution contained 30% (w/v) polyethylene glycol 3000, 0.2 M NaCl, 0.1 M Tris, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 294K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2006-03-03 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97945 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRL BEAMLINE BL11-1' _diffrn_source.pdbx_synchrotron_site SSRL _diffrn_source.pdbx_synchrotron_beamline BL11-1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97945 # _reflns.entry_id 2IT5 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 27.98 _reflns.d_resolution_high 2.4 _reflns.number_obs 6501 _reflns.number_all ? _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.085 _reflns.pdbx_netI_over_sigmaI 6.0 _reflns.B_iso_Wilson_estimate 34.4 _reflns.pdbx_redundancy 4.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.4 _reflns_shell.d_res_low 2.46 _reflns_shell.percent_possible_all 99.8 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.198 _reflns_shell.meanI_over_sigI_obs 3.2 _reflns_shell.pdbx_redundancy 4.8 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 2273 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2IT5 _refine.ls_number_reflns_obs 6501 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 1380833.41 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27.98 _refine.ls_d_res_high 2.40 _refine.ls_percent_reflns_obs 99.5 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.198 _refine.ls_R_factor_R_free 0.252 _refine.ls_R_factor_R_free_error 0.014 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.7 _refine.ls_number_reflns_R_free 303 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 27.3 _refine.aniso_B[1][1] 0.39 _refine.aniso_B[2][2] 0.39 _refine.aniso_B[3][3] -0.78 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.357237 _refine.solvent_model_param_bsol 32.8017 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1SL4' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2IT5 _refine_analyze.Luzzati_coordinate_error_obs 0.25 _refine_analyze.Luzzati_sigma_a_obs 0.23 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.36 _refine_analyze.Luzzati_sigma_a_free 0.25 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1070 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 60 _refine_hist.number_atoms_solvent 59 _refine_hist.number_atoms_total 1189 _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 27.98 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.6 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.78 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.43 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.44 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.22 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.27 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.40 _refine_ls_shell.d_res_low 2.55 _refine_ls_shell.number_reflns_R_work 1023 _refine_ls_shell.R_factor_R_work 0.249 _refine_ls_shell.percent_reflns_obs 99.9 _refine_ls_shell.R_factor_R_free 0.27 _refine_ls_shell.R_factor_R_free_error 0.035 _refine_ls_shell.percent_reflns_R_free 5.5 _refine_ls_shell.number_reflns_R_free 59 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 1075 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 ion.param water.top 'X-RAY DIFFRACTION' 3 water_rep.param ion.top 'X-RAY DIFFRACTION' 4 carbohydrate.param carbohydrate.top 'X-RAY DIFFRACTION' # _struct.entry_id 2IT5 _struct.title 'Crystal Structure of DCSIGN-CRD with man6' _struct.pdbx_descriptor 'CD209 antigen, DCSIGN-CRD' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2IT5 _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text 'C-TYPE LECTIN, PROTEIN CARBOHYDRATE COMPLEX, IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 _struct_biol.details ;Copies C and D overlap and are present at 75% and 25% occupancy. A given unit cell can only have one of the two, and they are likely randomly distributed throughout the crystal. ; _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 27 ? VAL A 38 ? ASN A 276 VAL A 287 1 ? 12 HELX_P HELX_P2 2 SER A 47 ? ASN A 62 ? SER A 296 ASN A 311 1 ? 16 HELX_P HELX_P3 3 PHE A 90 ? TRP A 94 ? PHE A 339 TRP A 343 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 135 SG ? ? A CYS 253 A CYS 384 1_555 ? ? ? ? ? ? ? 2.036 ? ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 18 SG ? ? A CYS 256 A CYS 267 1_555 ? ? ? ? ? ? ? 2.039 ? ? disulf3 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 128 SG ? ? A CYS 284 A CYS 377 1_555 ? ? ? ? ? ? ? 2.045 ? ? disulf4 disulf ? ? A CYS 107 SG ? ? ? 1_555 A CYS 120 SG ? ? A CYS 356 A CYS 369 1_555 ? ? ? ? ? ? ? 2.041 ? ? covale1 covale both ? B MAN . O3 A ? ? 1_555 B MAN . C1 A ? B MAN 1 B MAN 2 1_555 ? ? ? ? ? ? ? 1.403 ? ? covale2 covale both ? B MAN . O2 A ? ? 1_555 B MAN . C1 A ? B MAN 2 B MAN 3 1_555 ? ? ? ? ? ? ? 1.401 ? ? covale3 covale both ? B MAN . O2 B ? ? 1_555 B MAN . C1 B ? B MAN 2 B MAN 3 1_555 ? ? ? ? ? ? ? 1.403 ? ? metalc1 metalc ? ? C CA . CA ? ? ? 1_555 A ASP 71 OD2 ? ? A CA 101 A ASP 320 1_555 ? ? ? ? ? ? ? 2.399 ? ? metalc2 metalc ? ? C CA . CA ? ? ? 1_555 A ASP 71 OD1 ? ? A CA 101 A ASP 320 1_555 ? ? ? ? ? ? ? 2.741 ? ? metalc3 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 75 OE2 ? ? A CA 101 A GLU 324 1_555 ? ? ? ? ? ? ? 2.781 ? ? metalc4 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 75 OE1 ? ? A CA 101 A GLU 324 1_555 ? ? ? ? ? ? ? 2.605 ? ? metalc5 metalc ? ? C CA . CA ? ? ? 1_555 A ASN 101 OD1 ? ? A CA 101 A ASN 350 1_555 ? ? ? ? ? ? ? 2.229 ? ? metalc6 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 105 O ? ? A CA 101 A GLU 354 1_555 ? ? ? ? ? ? ? 2.579 ? ? metalc7 metalc ? ? C CA . CA ? ? ? 1_555 A ASP 106 OD1 ? ? A CA 101 A ASP 355 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc8 metalc ? ? C CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 101 A HOH 391 1_555 ? ? ? ? ? ? ? 2.067 ? ? metalc9 metalc ? ? D CA . CA ? ? ? 1_555 A GLU 98 OE1 ? ? A CA 102 A GLU 347 1_555 ? ? ? ? ? ? ? 2.517 ? ? metalc10 metalc ? ? D CA . CA ? ? ? 1_555 A ASN 100 OD1 ? ? A CA 102 A ASN 349 1_555 ? ? ? ? ? ? ? 2.671 ? ? metalc11 metalc ? ? D CA . CA ? ? ? 1_555 A GLU 105 OE1 ? ? A CA 102 A GLU 354 1_555 ? ? ? ? ? ? ? 2.490 ? ? metalc12 metalc ? ? D CA . CA ? ? ? 1_555 A ASN 116 OD1 ? ? A CA 102 A ASN 365 1_555 ? ? ? ? ? ? ? 2.402 ? ? metalc13 metalc ? ? D CA . CA ? ? ? 1_555 A ASP 117 OD1 ? ? A CA 102 A ASP 366 1_555 ? ? ? ? ? ? ? 2.256 ? ? metalc14 metalc ? ? D CA . CA ? ? ? 1_555 A ASP 117 O ? ? A CA 102 A ASP 366 1_555 ? ? ? ? ? ? ? 2.528 ? ? metalc15 metalc ? ? D CA . CA ? ? ? 1_555 B MAN . O3 A ? A CA 102 B MAN 2 1_555 ? ? ? ? ? ? ? 2.556 ? ? metalc16 metalc ? ? D CA . CA ? ? ? 1_555 B MAN . O3 B ? A CA 102 B MAN 2 1_555 ? ? ? ? ? ? ? 2.641 ? ? metalc17 metalc ? ? D CA . CA ? ? ? 1_555 B MAN . O4 A ? A CA 102 B MAN 2 1_555 ? ? ? ? ? ? ? 2.624 ? ? metalc18 metalc ? ? D CA . CA ? ? ? 1_555 B MAN . O4 B ? A CA 102 B MAN 2 1_555 ? ? ? ? ? ? ? 2.766 ? ? metalc19 metalc ? ? E CA . CA ? ? ? 1_555 A GLU 75 OE1 ? ? A CA 103 A GLU 324 1_555 ? ? ? ? ? ? ? 2.291 ? ? metalc20 metalc ? ? E CA . CA ? ? ? 1_555 A GLU 104 OE2 ? ? A CA 103 A GLU 353 1_555 ? ? ? ? ? ? ? 2.072 ? ? metalc21 metalc ? ? E CA . CA ? ? ? 1_555 A ASP 106 OD2 ? ? A CA 103 A ASP 355 1_555 ? ? ? ? ? ? ? 2.679 ? ? metalc22 metalc ? ? E CA . CA ? ? ? 1_555 A ASP 106 OD1 ? ? A CA 103 A ASP 355 1_555 ? ? ? ? ? ? ? 2.655 ? ? metalc23 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 103 A HOH 389 1_555 ? ? ? ? ? ? ? 2.444 ? ? metalc24 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 103 A HOH 390 1_555 ? ? ? ? ? ? ? 2.531 ? ? metalc25 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 103 A HOH 440 1_555 ? ? ? ? ? ? ? 2.305 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 98 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 347 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 99 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 348 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.28 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 12 ? PHE A 14 ? THR A 261 PHE A 263 A 2 ASN A 17 ? MET A 21 ? ASN A 266 MET A 270 A 3 PHE A 125 ? SER A 131 ? PHE A 374 SER A 380 A 4 THR A 65 ? SER A 70 ? THR A 314 SER A 319 A 5 GLN A 79 ? TRP A 80 ? GLN A 328 TRP A 329 B 1 GLN A 41 ? LEU A 42 ? GLN A 290 LEU A 291 B 2 PHE A 125 ? SER A 131 ? PHE A 374 SER A 380 B 3 THR A 65 ? SER A 70 ? THR A 314 SER A 319 B 4 CYS A 107 ? SER A 111 ? CYS A 356 SER A 360 B 5 GLY A 114 ? ASP A 118 ? GLY A 363 ASP A 367 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 12 ? N THR A 261 O TYR A 19 ? O TYR A 268 A 2 3 N CYS A 18 ? N CYS A 267 O LYS A 130 ? O LYS A 379 A 3 4 O PHE A 125 ? O PHE A 374 N TRP A 66 ? N TRP A 315 A 4 5 N SER A 70 ? N SER A 319 O GLN A 79 ? O GLN A 328 B 1 2 N GLN A 41 ? N GLN A 290 O LYS A 129 ? O LYS A 378 B 2 3 O PHE A 125 ? O PHE A 374 N TRP A 66 ? N TRP A 315 B 3 4 N THR A 65 ? N THR A 314 O PHE A 110 ? O PHE A 359 B 4 5 N SER A 111 ? N SER A 360 O GLY A 114 ? O GLY A 363 # _database_PDB_matrix.entry_id 2IT5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2IT5 _atom_sites.fract_transf_matrix[1][1] 0.017870 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017870 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018776 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 250 ? ? ? A . n A 1 2 ARG 2 251 ? ? ? A . n A 1 3 LEU 3 252 ? ? ? A . n A 1 4 CYS 4 253 253 CYS CYS A . n A 1 5 HIS 5 254 254 HIS HIS A . n A 1 6 PRO 6 255 255 PRO PRO A . n A 1 7 CYS 7 256 256 CYS CYS A . n A 1 8 PRO 8 257 257 PRO PRO A . n A 1 9 TRP 9 258 258 TRP TRP A . n A 1 10 GLU 10 259 259 GLU GLU A . n A 1 11 TRP 11 260 260 TRP TRP A . n A 1 12 THR 12 261 261 THR THR A . n A 1 13 PHE 13 262 262 PHE PHE A . n A 1 14 PHE 14 263 263 PHE PHE A . n A 1 15 GLN 15 264 264 GLN GLN A . n A 1 16 GLY 16 265 265 GLY GLY A . n A 1 17 ASN 17 266 266 ASN ASN A . n A 1 18 CYS 18 267 267 CYS CYS A . n A 1 19 TYR 19 268 268 TYR TYR A . n A 1 20 PHE 20 269 269 PHE PHE A . n A 1 21 MET 21 270 270 MET MET A . n A 1 22 SER 22 271 271 SER SER A . n A 1 23 ASN 23 272 272 ASN ASN A . n A 1 24 SER 24 273 273 SER SER A . n A 1 25 GLN 25 274 274 GLN GLN A . n A 1 26 ARG 26 275 275 ARG ARG A . n A 1 27 ASN 27 276 276 ASN ASN A . n A 1 28 TRP 28 277 277 TRP TRP A . n A 1 29 HIS 29 278 278 HIS HIS A . n A 1 30 ASP 30 279 279 ASP ASP A . n A 1 31 SER 31 280 280 SER SER A . n A 1 32 ILE 32 281 281 ILE ILE A . n A 1 33 THR 33 282 282 THR THR A . n A 1 34 ALA 34 283 283 ALA ALA A . n A 1 35 CYS 35 284 284 CYS CYS A . n A 1 36 LYS 36 285 285 LYS LYS A . n A 1 37 GLU 37 286 286 GLU GLU A . n A 1 38 VAL 38 287 287 VAL VAL A . n A 1 39 GLY 39 288 288 GLY GLY A . n A 1 40 ALA 40 289 289 ALA ALA A . n A 1 41 GLN 41 290 290 GLN GLN A . n A 1 42 LEU 42 291 291 LEU LEU A . n A 1 43 VAL 43 292 292 VAL VAL A . n A 1 44 VAL 44 293 293 VAL VAL A . n A 1 45 ILE 45 294 294 ILE ILE A . n A 1 46 LYS 46 295 295 LYS LYS A . n A 1 47 SER 47 296 296 SER SER A . n A 1 48 ALA 48 297 297 ALA ALA A . n A 1 49 GLU 49 298 298 GLU GLU A . n A 1 50 GLU 50 299 299 GLU GLU A . n A 1 51 GLN 51 300 300 GLN GLN A . n A 1 52 ASN 52 301 301 ASN ASN A . n A 1 53 PHE 53 302 302 PHE PHE A . n A 1 54 LEU 54 303 303 LEU LEU A . n A 1 55 GLN 55 304 304 GLN GLN A . n A 1 56 LEU 56 305 305 LEU LEU A . n A 1 57 GLN 57 306 306 GLN GLN A . n A 1 58 SER 58 307 307 SER SER A . n A 1 59 SER 59 308 308 SER SER A . n A 1 60 ARG 60 309 309 ARG ARG A . n A 1 61 SER 61 310 310 SER SER A . n A 1 62 ASN 62 311 311 ASN ASN A . n A 1 63 ARG 63 312 312 ARG ARG A . n A 1 64 PHE 64 313 313 PHE PHE A . n A 1 65 THR 65 314 314 THR THR A . n A 1 66 TRP 66 315 315 TRP TRP A . n A 1 67 MET 67 316 316 MET MET A . n A 1 68 GLY 68 317 317 GLY GLY A . n A 1 69 LEU 69 318 318 LEU LEU A . n A 1 70 SER 70 319 319 SER SER A . n A 1 71 ASP 71 320 320 ASP ASP A . n A 1 72 LEU 72 321 321 LEU LEU A . n A 1 73 ASN 73 322 322 ASN ASN A . n A 1 74 GLN 74 323 323 GLN GLN A . n A 1 75 GLU 75 324 324 GLU GLU A . n A 1 76 GLY 76 325 325 GLY GLY A . n A 1 77 THR 77 326 326 THR THR A . n A 1 78 TRP 78 327 327 TRP TRP A . n A 1 79 GLN 79 328 328 GLN GLN A . n A 1 80 TRP 80 329 329 TRP TRP A . n A 1 81 VAL 81 330 330 VAL VAL A . n A 1 82 ASP 82 331 331 ASP ASP A . n A 1 83 GLY 83 332 332 GLY GLY A . n A 1 84 SER 84 333 333 SER SER A . n A 1 85 PRO 85 334 334 PRO PRO A . n A 1 86 LEU 86 335 335 LEU LEU A . n A 1 87 LEU 87 336 336 LEU LEU A . n A 1 88 PRO 88 337 337 PRO PRO A . n A 1 89 SER 89 338 338 SER SER A . n A 1 90 PHE 90 339 339 PHE PHE A . n A 1 91 LYS 91 340 340 LYS LYS A . n A 1 92 GLN 92 341 341 GLN GLN A . n A 1 93 TYR 93 342 342 TYR TYR A . n A 1 94 TRP 94 343 343 TRP TRP A . n A 1 95 ASN 95 344 344 ASN ASN A . n A 1 96 ARG 96 345 345 ARG ARG A . n A 1 97 GLY 97 346 346 GLY GLY A . n A 1 98 GLU 98 347 347 GLU GLU A . n A 1 99 PRO 99 348 348 PRO PRO A . n A 1 100 ASN 100 349 349 ASN ASN A . n A 1 101 ASN 101 350 350 ASN ASN A . n A 1 102 VAL 102 351 351 VAL VAL A . n A 1 103 GLY 103 352 352 GLY GLY A . n A 1 104 GLU 104 353 353 GLU GLU A . n A 1 105 GLU 105 354 354 GLU GLU A . n A 1 106 ASP 106 355 355 ASP ASP A . n A 1 107 CYS 107 356 356 CYS CYS A . n A 1 108 ALA 108 357 357 ALA ALA A . n A 1 109 GLU 109 358 358 GLU GLU A . n A 1 110 PHE 110 359 359 PHE PHE A . n A 1 111 SER 111 360 360 SER SER A . n A 1 112 GLY 112 361 361 GLY GLY A . n A 1 113 ASN 113 362 362 ASN ASN A . n A 1 114 GLY 114 363 363 GLY GLY A . n A 1 115 TRP 115 364 364 TRP TRP A . n A 1 116 ASN 116 365 365 ASN ASN A . n A 1 117 ASP 117 366 366 ASP ASP A . n A 1 118 ASP 118 367 367 ASP ASP A . n A 1 119 LYS 119 368 368 LYS LYS A . n A 1 120 CYS 120 369 369 CYS CYS A . n A 1 121 ASN 121 370 370 ASN ASN A . n A 1 122 LEU 122 371 371 LEU LEU A . n A 1 123 ALA 123 372 372 ALA ALA A . n A 1 124 LYS 124 373 373 LYS LYS A . n A 1 125 PHE 125 374 374 PHE PHE A . n A 1 126 TRP 126 375 375 TRP TRP A . n A 1 127 ILE 127 376 376 ILE ILE A . n A 1 128 CYS 128 377 377 CYS CYS A . n A 1 129 LYS 129 378 378 LYS LYS A . n A 1 130 LYS 130 379 379 LYS LYS A . n A 1 131 SER 131 380 380 SER SER A . n A 1 132 ALA 132 381 381 ALA ALA A . n A 1 133 ALA 133 382 382 ALA ALA A . n A 1 134 SER 134 383 383 SER SER A . n A 1 135 CYS 135 384 384 CYS CYS A . n A 1 136 SER 136 385 ? ? ? A . n A 1 137 ARG 137 386 ? ? ? A . n A 1 138 ASP 138 387 ? ? ? A . n A 1 139 GLU 139 388 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 101 101 CA CA A . D 3 CA 1 102 102 CA CA A . E 3 CA 1 103 103 CA CA A . F 4 HOH 1 389 1 HOH HOH A . F 4 HOH 2 390 2 HOH HOH A . F 4 HOH 3 391 3 HOH HOH A . F 4 HOH 4 392 4 HOH HOH A . F 4 HOH 5 393 5 HOH HOH A . F 4 HOH 6 394 6 HOH HOH A . F 4 HOH 7 395 7 HOH HOH A . F 4 HOH 8 396 8 HOH HOH A . F 4 HOH 9 397 9 HOH HOH A . F 4 HOH 10 398 10 HOH HOH A . F 4 HOH 11 399 11 HOH HOH A . F 4 HOH 12 400 12 HOH HOH A . F 4 HOH 13 401 13 HOH HOH A . F 4 HOH 14 402 14 HOH HOH A . F 4 HOH 15 403 15 HOH HOH A . F 4 HOH 16 404 16 HOH HOH A . F 4 HOH 17 405 17 HOH HOH A . F 4 HOH 18 406 18 HOH HOH A . F 4 HOH 19 407 19 HOH HOH A . F 4 HOH 20 408 20 HOH HOH A . F 4 HOH 21 409 21 HOH HOH A . F 4 HOH 22 410 22 HOH HOH A . F 4 HOH 23 411 23 HOH HOH A . F 4 HOH 24 412 24 HOH HOH A . F 4 HOH 25 413 25 HOH HOH A . F 4 HOH 26 414 26 HOH HOH A . F 4 HOH 27 415 27 HOH HOH A . F 4 HOH 28 416 28 HOH HOH A . F 4 HOH 29 417 29 HOH HOH A . F 4 HOH 30 418 30 HOH HOH A . F 4 HOH 31 419 31 HOH HOH A . F 4 HOH 32 420 32 HOH HOH A . F 4 HOH 33 421 33 HOH HOH A . F 4 HOH 34 422 34 HOH HOH A . F 4 HOH 35 423 35 HOH HOH A . F 4 HOH 36 424 36 HOH HOH A . F 4 HOH 37 425 37 HOH HOH A . F 4 HOH 38 426 38 HOH HOH A . F 4 HOH 39 427 39 HOH HOH A . F 4 HOH 40 428 40 HOH HOH A . F 4 HOH 41 429 41 HOH HOH A . F 4 HOH 42 430 42 HOH HOH A . F 4 HOH 43 431 43 HOH HOH A . F 4 HOH 44 432 44 HOH HOH A . F 4 HOH 45 433 45 HOH HOH A . F 4 HOH 46 434 46 HOH HOH A . F 4 HOH 47 435 47 HOH HOH A . F 4 HOH 48 436 48 HOH HOH A . F 4 HOH 49 437 49 HOH HOH A . F 4 HOH 50 438 50 HOH HOH A . F 4 HOH 51 439 51 HOH HOH A . F 4 HOH 52 440 52 HOH HOH A . F 4 HOH 53 441 53 HOH HOH A . F 4 HOH 54 442 54 HOH HOH A . F 4 HOH 55 443 55 HOH HOH A . F 4 HOH 56 444 56 HOH HOH A . F 4 HOH 57 445 57 HOH HOH A . F 4 HOH 58 446 58 HOH HOH A . F 4 HOH 59 447 59 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 71 ? A ASP 320 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASP 71 ? A ASP 320 ? 1_555 50.0 ? 2 OD2 ? A ASP 71 ? A ASP 320 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE2 ? A GLU 75 ? A GLU 324 ? 1_555 74.2 ? 3 OD1 ? A ASP 71 ? A ASP 320 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE2 ? A GLU 75 ? A GLU 324 ? 1_555 120.5 ? 4 OD2 ? A ASP 71 ? A ASP 320 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 75 ? A GLU 324 ? 1_555 81.8 ? 5 OD1 ? A ASP 71 ? A ASP 320 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 75 ? A GLU 324 ? 1_555 99.1 ? 6 OE2 ? A GLU 75 ? A GLU 324 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OE1 ? A GLU 75 ? A GLU 324 ? 1_555 48.1 ? 7 OD2 ? A ASP 71 ? A ASP 320 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASN 101 ? A ASN 350 ? 1_555 146.6 ? 8 OD1 ? A ASP 71 ? A ASP 320 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASN 101 ? A ASN 350 ? 1_555 163.2 ? 9 OE2 ? A GLU 75 ? A GLU 324 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASN 101 ? A ASN 350 ? 1_555 73.8 ? 10 OE1 ? A GLU 75 ? A GLU 324 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASN 101 ? A ASN 350 ? 1_555 84.1 ? 11 OD2 ? A ASP 71 ? A ASP 320 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A GLU 105 ? A GLU 354 ? 1_555 125.0 ? 12 OD1 ? A ASP 71 ? A ASP 320 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A GLU 105 ? A GLU 354 ? 1_555 92.0 ? 13 OE2 ? A GLU 75 ? A GLU 324 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A GLU 105 ? A GLU 354 ? 1_555 142.7 ? 14 OE1 ? A GLU 75 ? A GLU 324 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A GLU 105 ? A GLU 354 ? 1_555 150.7 ? 15 OD1 ? A ASN 101 ? A ASN 350 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? A GLU 105 ? A GLU 354 ? 1_555 78.0 ? 16 OD2 ? A ASP 71 ? A ASP 320 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASP 106 ? A ASP 355 ? 1_555 113.3 ? 17 OD1 ? A ASP 71 ? A ASP 320 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASP 106 ? A ASP 355 ? 1_555 71.2 ? 18 OE2 ? A GLU 75 ? A GLU 324 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASP 106 ? A ASP 355 ? 1_555 126.1 ? 19 OE1 ? A GLU 75 ? A GLU 324 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASP 106 ? A ASP 355 ? 1_555 79.1 ? 20 OD1 ? A ASN 101 ? A ASN 350 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASP 106 ? A ASP 355 ? 1_555 93.4 ? 21 O ? A GLU 105 ? A GLU 354 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 OD1 ? A ASP 106 ? A ASP 355 ? 1_555 79.0 ? 22 OD2 ? A ASP 71 ? A ASP 320 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? F HOH . ? A HOH 391 ? 1_555 86.6 ? 23 OD1 ? A ASP 71 ? A ASP 320 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? F HOH . ? A HOH 391 ? 1_555 109.5 ? 24 OE2 ? A GLU 75 ? A GLU 324 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? F HOH . ? A HOH 391 ? 1_555 82.2 ? 25 OE1 ? A GLU 75 ? A GLU 324 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? F HOH . ? A HOH 391 ? 1_555 130.3 ? 26 OD1 ? A ASN 101 ? A ASN 350 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? F HOH . ? A HOH 391 ? 1_555 79.8 ? 27 O ? A GLU 105 ? A GLU 354 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? F HOH . ? A HOH 391 ? 1_555 69.1 ? 28 OD1 ? A ASP 106 ? A ASP 355 ? 1_555 CA ? C CA . ? A CA 101 ? 1_555 O ? F HOH . ? A HOH 391 ? 1_555 148.0 ? 29 OE1 ? A GLU 98 ? A GLU 347 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASN 100 ? A ASN 349 ? 1_555 82.3 ? 30 OE1 ? A GLU 98 ? A GLU 347 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OE1 ? A GLU 105 ? A GLU 354 ? 1_555 148.5 ? 31 OD1 ? A ASN 100 ? A ASN 349 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OE1 ? A GLU 105 ? A GLU 354 ? 1_555 67.7 ? 32 OE1 ? A GLU 98 ? A GLU 347 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASN 116 ? A ASN 365 ? 1_555 66.6 ? 33 OD1 ? A ASN 100 ? A ASN 349 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASN 116 ? A ASN 365 ? 1_555 145.4 ? 34 OE1 ? A GLU 105 ? A GLU 354 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASN 116 ? A ASN 365 ? 1_555 144.9 ? 35 OE1 ? A GLU 98 ? A GLU 347 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 117 ? A ASP 366 ? 1_555 77.2 ? 36 OD1 ? A ASN 100 ? A ASN 349 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 117 ? A ASP 366 ? 1_555 92.6 ? 37 OE1 ? A GLU 105 ? A GLU 354 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 117 ? A ASP 366 ? 1_555 94.3 ? 38 OD1 ? A ASN 116 ? A ASN 365 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 OD1 ? A ASP 117 ? A ASP 366 ? 1_555 94.7 ? 39 OE1 ? A GLU 98 ? A GLU 347 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O ? A ASP 117 ? A ASP 366 ? 1_555 136.1 ? 40 OD1 ? A ASN 100 ? A ASN 349 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O ? A ASP 117 ? A ASP 366 ? 1_555 132.2 ? 41 OE1 ? A GLU 105 ? A GLU 354 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O ? A ASP 117 ? A ASP 366 ? 1_555 67.4 ? 42 OD1 ? A ASN 116 ? A ASN 365 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O ? A ASP 117 ? A ASP 366 ? 1_555 82.3 ? 43 OD1 ? A ASP 117 ? A ASP 366 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O ? A ASP 117 ? A ASP 366 ? 1_555 75.4 ? 44 OE1 ? A GLU 98 ? A GLU 347 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O3 A B MAN . ? B MAN 2 ? 1_555 70.9 ? 45 OD1 ? A ASN 100 ? A ASN 349 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O3 A B MAN . ? B MAN 2 ? 1_555 77.7 ? 46 OE1 ? A GLU 105 ? A GLU 354 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O3 A B MAN . ? B MAN 2 ? 1_555 109.8 ? 47 OD1 ? A ASN 116 ? A ASN 365 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O3 A B MAN . ? B MAN 2 ? 1_555 78.1 ? 48 OD1 ? A ASP 117 ? A ASP 366 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O3 A B MAN . ? B MAN 2 ? 1_555 147.6 ? 49 O ? A ASP 117 ? A ASP 366 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O3 A B MAN . ? B MAN 2 ? 1_555 133.4 ? 50 OE1 ? A GLU 98 ? A GLU 347 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O3 B B MAN . ? B MAN 2 ? 1_555 134.0 ? 51 OD1 ? A ASN 100 ? A ASN 349 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O3 B B MAN . ? B MAN 2 ? 1_555 106.3 ? 52 OE1 ? A GLU 105 ? A GLU 354 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O3 B B MAN . ? B MAN 2 ? 1_555 67.0 ? 53 OD1 ? A ASN 116 ? A ASN 365 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O3 B B MAN . ? B MAN 2 ? 1_555 86.6 ? 54 OD1 ? A ASP 117 ? A ASP 366 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O3 B B MAN . ? B MAN 2 ? 1_555 144.5 ? 55 O ? A ASP 117 ? A ASP 366 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O3 B B MAN . ? B MAN 2 ? 1_555 69.7 ? 56 O3 A B MAN . ? B MAN 2 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O3 B B MAN . ? B MAN 2 ? 1_555 67.3 ? 57 OE1 ? A GLU 98 ? A GLU 347 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 A B MAN . ? B MAN 2 ? 1_555 132.4 ? 58 OD1 ? A ASN 100 ? A ASN 349 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 A B MAN . ? B MAN 2 ? 1_555 107.5 ? 59 OE1 ? A GLU 105 ? A GLU 354 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 A B MAN . ? B MAN 2 ? 1_555 69.0 ? 60 OD1 ? A ASN 116 ? A ASN 365 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 A B MAN . ? B MAN 2 ? 1_555 84.7 ? 61 OD1 ? A ASP 117 ? A ASP 366 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 A B MAN . ? B MAN 2 ? 1_555 145.1 ? 62 O ? A ASP 117 ? A ASP 366 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 A B MAN . ? B MAN 2 ? 1_555 70.0 ? 63 O3 A B MAN . ? B MAN 2 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 A B MAN . ? B MAN 2 ? 1_555 66.4 ? 64 O3 B B MAN . ? B MAN 2 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 A B MAN . ? B MAN 2 ? 1_555 2.0 ? 65 OE1 ? A GLU 98 ? A GLU 347 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 B B MAN . ? B MAN 2 ? 1_555 76.8 ? 66 OD1 ? A ASN 100 ? A ASN 349 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 B B MAN . ? B MAN 2 ? 1_555 73.8 ? 67 OE1 ? A GLU 105 ? A GLU 354 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 B B MAN . ? B MAN 2 ? 1_555 102.6 ? 68 OD1 ? A ASN 116 ? A ASN 365 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 B B MAN . ? B MAN 2 ? 1_555 84.3 ? 69 OD1 ? A ASP 117 ? A ASP 366 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 B B MAN . ? B MAN 2 ? 1_555 152.0 ? 70 O ? A ASP 117 ? A ASP 366 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 B B MAN . ? B MAN 2 ? 1_555 131.8 ? 71 O3 A B MAN . ? B MAN 2 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 B B MAN . ? B MAN 2 ? 1_555 7.3 ? 72 O3 B B MAN . ? B MAN 2 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 B B MAN . ? B MAN 2 ? 1_555 63.5 ? 73 O4 A B MAN . ? B MAN 2 ? 1_555 CA ? D CA . ? A CA 102 ? 1_555 O4 B B MAN . ? B MAN 2 ? 1_555 62.8 ? 74 OE1 ? A GLU 75 ? A GLU 324 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 OE2 ? A GLU 104 ? A GLU 353 ? 1_555 90.5 ? 75 OE1 ? A GLU 75 ? A GLU 324 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 OD2 ? A ASP 106 ? A ASP 355 ? 1_555 122.4 ? 76 OE2 ? A GLU 104 ? A GLU 353 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 OD2 ? A ASP 106 ? A ASP 355 ? 1_555 102.3 ? 77 OE1 ? A GLU 75 ? A GLU 324 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 OD1 ? A ASP 106 ? A ASP 355 ? 1_555 78.8 ? 78 OE2 ? A GLU 104 ? A GLU 353 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 OD1 ? A ASP 106 ? A ASP 355 ? 1_555 82.0 ? 79 OD2 ? A ASP 106 ? A ASP 355 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 OD1 ? A ASP 106 ? A ASP 355 ? 1_555 48.9 ? 80 OE1 ? A GLU 75 ? A GLU 324 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 O ? F HOH . ? A HOH 389 ? 1_555 92.7 ? 81 OE2 ? A GLU 104 ? A GLU 353 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 O ? F HOH . ? A HOH 389 ? 1_555 176.0 ? 82 OD2 ? A ASP 106 ? A ASP 355 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 O ? F HOH . ? A HOH 389 ? 1_555 73.9 ? 83 OD1 ? A ASP 106 ? A ASP 355 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 O ? F HOH . ? A HOH 389 ? 1_555 96.2 ? 84 OE1 ? A GLU 75 ? A GLU 324 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 O ? F HOH . ? A HOH 390 ? 1_555 82.4 ? 85 OE2 ? A GLU 104 ? A GLU 353 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 O ? F HOH . ? A HOH 390 ? 1_555 91.9 ? 86 OD2 ? A ASP 106 ? A ASP 355 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 O ? F HOH . ? A HOH 390 ? 1_555 150.8 ? 87 OD1 ? A ASP 106 ? A ASP 355 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 O ? F HOH . ? A HOH 390 ? 1_555 160.1 ? 88 O ? F HOH . ? A HOH 389 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 O ? F HOH . ? A HOH 390 ? 1_555 91.0 ? 89 OE1 ? A GLU 75 ? A GLU 324 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 O ? F HOH . ? A HOH 440 ? 1_555 163.0 ? 90 OE2 ? A GLU 104 ? A GLU 353 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 O ? F HOH . ? A HOH 440 ? 1_555 98.6 ? 91 OD2 ? A ASP 106 ? A ASP 355 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 O ? F HOH . ? A HOH 440 ? 1_555 69.8 ? 92 OD1 ? A ASP 106 ? A ASP 355 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 O ? F HOH . ? A HOH 440 ? 1_555 116.6 ? 93 O ? F HOH . ? A HOH 389 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 O ? F HOH . ? A HOH 440 ? 1_555 79.0 ? 94 O ? F HOH . ? A HOH 390 ? 1_555 CA ? E CA . ? A CA 103 ? 1_555 O ? F HOH . ? A HOH 440 ? 1_555 83.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-12-05 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' chem_comp 3 4 'Structure model' entity 4 4 'Structure model' pdbx_branch_scheme 5 4 'Structure model' pdbx_chem_comp_identifier 6 4 'Structure model' pdbx_entity_branch 7 4 'Structure model' pdbx_entity_branch_descriptor 8 4 'Structure model' pdbx_entity_branch_link 9 4 'Structure model' pdbx_entity_branch_list 10 4 'Structure model' pdbx_entity_nonpoly 11 4 'Structure model' pdbx_nonpoly_scheme 12 4 'Structure model' pdbx_struct_assembly_gen 13 4 'Structure model' pdbx_struct_conn_angle 14 4 'Structure model' struct_asym 15 4 'Structure model' struct_conn 16 4 'Structure model' struct_site 17 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.auth_asym_id' 2 4 'Structure model' '_atom_site.auth_seq_id' 3 4 'Structure model' '_atom_site.label_asym_id' 4 4 'Structure model' '_chem_comp.name' 5 4 'Structure model' '_chem_comp.type' 6 4 'Structure model' '_entity.formula_weight' 7 4 'Structure model' '_entity.pdbx_description' 8 4 'Structure model' '_entity.pdbx_number_of_molecules' 9 4 'Structure model' '_entity.type' 10 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_alt_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_alt_id' 24 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 25 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 26 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 27 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 28 4 'Structure model' '_pdbx_struct_conn_angle.value' 29 4 'Structure model' '_struct_conn.pdbx_dist_value' 30 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 31 4 'Structure model' '_struct_conn.pdbx_ptnr2_label_alt_id' 32 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 33 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 34 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 35 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 36 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 37 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 38 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 39 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 40 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 41 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 Blu-Ice 'data collection' . ? 2 MOSFLM 'data reduction' . ? 3 CCP4 'data scaling' '(SCALA)' ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 289 ? ? -128.27 -166.79 2 1 VAL A 292 ? ? -32.84 119.65 3 1 GLU A 353 ? ? 73.25 83.93 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 250 ? A GLU 1 2 1 Y 1 A ARG 251 ? A ARG 2 3 1 Y 1 A LEU 252 ? A LEU 3 4 1 Y 1 A SER 385 ? A SER 136 5 1 Y 1 A ARG 386 ? A ARG 137 6 1 Y 1 A ASP 387 ? A ASP 138 7 1 Y 1 A GLU 388 ? A GLU 139 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 MAN 1 B MAN 1 C MAN 2 n B 2 MAN 2 B MAN 2 C MAN 3 n B 2 MAN 3 B MAN 3 C MAN 5 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpa MAN 'COMMON NAME' GMML 1.0 a-D-mannopyranose MAN 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Manp MAN 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DManpa1-2DManpa1-3DManpa1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,3,2/[a1122h-1a_1-5]/1-1-1/a3-b1_b2-c1' WURCS PDB2Glycan 1.1.0 3 2 '[][a-D-Manp]{[(3+1)][a-D-Manp]{[(2+1)][a-D-Manp]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 MAN C1 O1 1 MAN O3 HO3 sing ? 2 2 3 MAN C1 O1 2 MAN O2 HO2 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 MAN 1 n 2 MAN 2 n 2 MAN 3 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CALCIUM ION' CA 4 water HOH #