data_2J7M # _entry.id 2J7M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2J7M PDBE EBI-30224 WWPDB D_1290030224 # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2006-10-16 _pdbx_database_PDB_obs_spr.pdb_id 2J7M _pdbx_database_PDB_obs_spr.replace_pdb_id 2J1F _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2CBI unspecified 'STRUCTURE OF THE CLOSTRIDIUM PERFRINGENS NAGJ FAMILY 84 GLYCOSIDE HYDROLASE, A HOMOLOGUE OF HUMAN O-GLCNACASE' PDB 2CBJ unspecified ;STRUCTURE OF THE CLOSTRIDIUM PERFRINGENS NAGJ FAMILY 84 GLYCOSIDE HYDROLASE, A HOMOLOGUE OF HUMAN O-GLCNACASE IN COMPLEX WITH PUGNAC ; PDB 2J1A unspecified 'STRUCTURE OF CBM32 FROM CLOSTRIDIUM PERFRINGENS BETA-N-ACETYLHEXOSAMINIDASE GH84C IN COMPLEX WITH GALACTOSE' PDB 2J1E unspecified 'HIGH RESOLUTION CRYSTAL STRUCTURE OF CBM32 FROM A N-ACETYL-BETA-HEXOSAMINIDASE IN COMPLEX WITH LACNAC' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2J7M _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2006-10-12 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ficko-Blean, E.' 1 'Boraston, A.B.' 2 # _citation.id primary _citation.title ;The Interaction of a Carbohydrate-Binding Module from a Clostridium Perfringens N-Acetyl-Beta-Hexosaminidase with its Carbohydrate Receptor ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 281 _citation.page_first 37748 _citation.page_last ? _citation.year 2006 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16990278 _citation.pdbx_database_id_DOI 10.1074/JBC.M606126200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ficko-Blean, E.' 1 ? primary 'Boraston, A.B.' 2 ? # _cell.entry_id 2J7M _cell.length_a 77.315 _cell.length_b 77.315 _cell.length_c 74.162 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2J7M _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man HYALURONIDASE 16285.709 1 ? ? 'RESIDUES 625-767' ? 2 branched man 'alpha-L-fucopyranose-(1-2)-beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose' 529.490 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 water nat water 18.015 209 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 CBM32 2 'H type 2 antigen, alpha anomer' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GIDPFTNPRTVKITASSEETSGENAPASFASDGDMNTFWHSKWSSPAHEGPHHLTLELDNVYEINKVKYAPRQDSKNGRI TGYKVSVSLDGENFTEVKTGTLEDNAAIKFIEFDSVDAKYVRLDVTDSVSDQANGRGKFATAAEVNVHG ; _entity_poly.pdbx_seq_one_letter_code_can ;GIDPFTNPRTVKITASSEETSGENAPASFASDGDMNTFWHSKWSSPAHEGPHHLTLELDNVYEINKVKYAPRQDSKNGRI TGYKVSVSLDGENFTEVKTGTLEDNAAIKFIEFDSVDAKYVRLDVTDSVSDQANGRGKFATAAEVNVHG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 ASP n 1 4 PRO n 1 5 PHE n 1 6 THR n 1 7 ASN n 1 8 PRO n 1 9 ARG n 1 10 THR n 1 11 VAL n 1 12 LYS n 1 13 ILE n 1 14 THR n 1 15 ALA n 1 16 SER n 1 17 SER n 1 18 GLU n 1 19 GLU n 1 20 THR n 1 21 SER n 1 22 GLY n 1 23 GLU n 1 24 ASN n 1 25 ALA n 1 26 PRO n 1 27 ALA n 1 28 SER n 1 29 PHE n 1 30 ALA n 1 31 SER n 1 32 ASP n 1 33 GLY n 1 34 ASP n 1 35 MET n 1 36 ASN n 1 37 THR n 1 38 PHE n 1 39 TRP n 1 40 HIS n 1 41 SER n 1 42 LYS n 1 43 TRP n 1 44 SER n 1 45 SER n 1 46 PRO n 1 47 ALA n 1 48 HIS n 1 49 GLU n 1 50 GLY n 1 51 PRO n 1 52 HIS n 1 53 HIS n 1 54 LEU n 1 55 THR n 1 56 LEU n 1 57 GLU n 1 58 LEU n 1 59 ASP n 1 60 ASN n 1 61 VAL n 1 62 TYR n 1 63 GLU n 1 64 ILE n 1 65 ASN n 1 66 LYS n 1 67 VAL n 1 68 LYS n 1 69 TYR n 1 70 ALA n 1 71 PRO n 1 72 ARG n 1 73 GLN n 1 74 ASP n 1 75 SER n 1 76 LYS n 1 77 ASN n 1 78 GLY n 1 79 ARG n 1 80 ILE n 1 81 THR n 1 82 GLY n 1 83 TYR n 1 84 LYS n 1 85 VAL n 1 86 SER n 1 87 VAL n 1 88 SER n 1 89 LEU n 1 90 ASP n 1 91 GLY n 1 92 GLU n 1 93 ASN n 1 94 PHE n 1 95 THR n 1 96 GLU n 1 97 VAL n 1 98 LYS n 1 99 THR n 1 100 GLY n 1 101 THR n 1 102 LEU n 1 103 GLU n 1 104 ASP n 1 105 ASN n 1 106 ALA n 1 107 ALA n 1 108 ILE n 1 109 LYS n 1 110 PHE n 1 111 ILE n 1 112 GLU n 1 113 PHE n 1 114 ASP n 1 115 SER n 1 116 VAL n 1 117 ASP n 1 118 ALA n 1 119 LYS n 1 120 TYR n 1 121 VAL n 1 122 ARG n 1 123 LEU n 1 124 ASP n 1 125 VAL n 1 126 THR n 1 127 ASP n 1 128 SER n 1 129 VAL n 1 130 SER n 1 131 ASP n 1 132 GLN n 1 133 ALA n 1 134 ASN n 1 135 GLY n 1 136 ARG n 1 137 GLY n 1 138 LYS n 1 139 PHE n 1 140 ALA n 1 141 THR n 1 142 ALA n 1 143 ALA n 1 144 GLU n 1 145 VAL n 1 146 ASN n 1 147 VAL n 1 148 HIS n 1 149 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'CLOSTRIDIUM PERFRINGENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1502 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 13124 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 2J7M 1 ? ? 2J7M ? 2 UNP Q8XL08_CLOPE 1 ? ? Q8XL08 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2J7M A 1 ? 6 ? 2J7M 619 ? 624 ? 619 624 2 2 2J7M A 7 ? 149 ? Q8XL08 625 ? 767 ? 625 767 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose ? 'C6 H12 O5' 164.156 GAL 'D-saccharide, beta linking' . beta-D-galactopyranose ? 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NDG 'D-saccharide, alpha linking' . 2-acetamido-2-deoxy-alpha-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2J7M _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.93 _exptl_crystal.density_percent_sol 57.75 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp 113.2 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2J7M _reflns.observed_criterion_sigma_I 2.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.000 _reflns.d_resolution_high 2.300 _reflns.number_obs 10441 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.12000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 7.8000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.870 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2J7M _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 9939 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 54.64 _refine.ls_d_res_high 2.30 _refine.ls_percent_reflns_obs 99.6 _refine.ls_R_factor_obs 0.191 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.188 _refine.ls_R_factor_R_free 0.251 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.800 _refine.ls_number_reflns_R_free 501 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.950 _refine.correlation_coeff_Fo_to_Fc_free 0.906 _refine.B_iso_mean 21.23 _refine.aniso_B[1][1] -0.42000 _refine.aniso_B[2][2] -0.42000 _refine.aniso_B[3][3] 0.85000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct OTHER _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.239 _refine.pdbx_overall_ESU_R_Free 0.216 _refine.overall_SU_ML 0.136 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 5.550 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1103 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 37 _refine_hist.number_atoms_solvent 209 _refine_hist.number_atoms_total 1349 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 54.64 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.015 0.021 ? 1164 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.635 1.962 ? 1583 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.958 5.000 ? 142 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 37.750 25.179 ? 56 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 15.559 15.000 ? 181 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 25.157 15.000 ? 5 'X-RAY DIFFRACTION' ? r_chiral_restr 0.097 0.200 ? 182 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.020 ? 877 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.203 0.200 ? 461 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.301 0.200 ? 780 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.188 0.200 ? 166 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.156 0.200 ? 20 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.499 0.200 ? 17 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.767 1.500 ? 722 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.366 2.000 ? 1141 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 2.234 3.000 ? 487 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 3.493 4.500 ? 442 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.30 _refine_ls_shell.d_res_low 2.36 _refine_ls_shell.number_reflns_R_work 719 _refine_ls_shell.R_factor_R_work 0.2150 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.2530 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 36 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2J7M _struct.title 'Characterization of a Family 32 CBM' _struct.pdbx_descriptor HYALURONIDASE _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2J7M _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'GLYCOSIDE HYDROLASE, CARBOHYDRATE BINDING, CBM, HYDROLASE, H-TRISACCHARIDE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 26 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 32 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 644 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 650 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B NDG . O4 ? ? ? 1_555 B GAL . C1 ? ? B NDG 1 B GAL 2 1_555 ? ? ? ? ? ? ? 1.444 ? ? covale2 covale both ? B GAL . O2 ? ? ? 1_555 B FUC . C1 ? ? B GAL 2 B FUC 3 1_555 ? ? ? ? ? ? ? 1.464 ? ? metalc1 metalc ? ? A PHE 29 O ? ? ? 1_555 C CA . CA ? ? A PHE 647 A CA 1768 1_555 ? ? ? ? ? ? ? 2.516 ? ? metalc2 metalc ? ? A ASP 32 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 650 A CA 1768 1_555 ? ? ? ? ? ? ? 2.933 ? ? metalc3 metalc ? ? A ASP 32 O ? ? ? 1_555 C CA . CA ? ? A ASP 650 A CA 1768 1_555 ? ? ? ? ? ? ? 3.391 ? ? metalc4 metalc ? ? A ASP 34 O ? ? ? 1_555 C CA . CA ? ? A ASP 652 A CA 1768 1_555 ? ? ? ? ? ? ? 2.572 ? ? metalc5 metalc ? ? A THR 37 OG1 ? ? ? 1_555 C CA . CA ? ? A THR 655 A CA 1768 1_555 ? ? ? ? ? ? ? 2.854 ? ? metalc6 metalc ? ? A THR 37 O ? ? ? 1_555 C CA . CA ? ? A THR 655 A CA 1768 1_555 ? ? ? ? ? ? ? 2.832 ? ? metalc7 metalc ? ? A ALA 143 O ? ? ? 1_555 C CA . CA ? ? A ALA 761 A CA 1768 1_555 ? ? ? ? ? ? ? 2.624 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 45 A . ? SER 663 A PRO 46 A ? PRO 664 A 1 -7.40 2 GLY 50 A . ? GLY 668 A PRO 51 A ? PRO 669 A 1 0.21 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 5 ? AB ? 3 ? AC ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AC 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 THR A 10 ? ALA A 15 ? THR A 628 ALA A 633 AA 2 HIS A 52 ? ALA A 70 ? HIS A 670 ALA A 688 AA 3 LYS A 109 ? SER A 128 ? LYS A 727 SER A 746 AA 4 ILE A 80 ? SER A 88 ? ILE A 698 SER A 706 AA 5 PHE A 94 ? THR A 101 ? PHE A 712 THR A 719 AB 1 THR A 10 ? ALA A 15 ? THR A 628 ALA A 633 AB 2 HIS A 52 ? ALA A 70 ? HIS A 670 ALA A 688 AB 3 GLU A 144 ? HIS A 148 ? GLU A 762 HIS A 766 AC 1 TRP A 39 ? HIS A 40 ? TRP A 657 HIS A 658 AC 2 THR A 141 ? ALA A 142 ? THR A 759 ALA A 760 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N THR A 14 ? N THR A 632 O THR A 55 ? O THR A 673 AA 2 3 N TYR A 69 ? N TYR A 687 O LYS A 109 ? O LYS A 727 AA 3 4 O ASP A 127 ? O ASP A 745 N THR A 81 ? N THR A 699 AA 4 5 N VAL A 87 ? N VAL A 705 O THR A 95 ? O THR A 713 AB 1 2 N THR A 14 ? N THR A 632 O THR A 55 ? O THR A 673 AB 2 3 N ALA A 70 ? N ALA A 688 O GLU A 144 ? O GLU A 762 AC 1 2 N TRP A 39 ? N TRP A 657 O ALA A 142 ? O ALA A 760 # _database_PDB_matrix.entry_id 2J7M _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2J7M _atom_sites.fract_transf_matrix[1][1] 0.012934 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012934 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013484 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 619 ? ? ? A . n A 1 2 ILE 2 620 ? ? ? A . n A 1 3 ASP 3 621 ? ? ? A . n A 1 4 PRO 4 622 ? ? ? A . n A 1 5 PHE 5 623 ? ? ? A . n A 1 6 THR 6 624 ? ? ? A . n A 1 7 ASN 7 625 625 ASN ASN A . n A 1 8 PRO 8 626 626 PRO PRO A . n A 1 9 ARG 9 627 627 ARG ARG A . n A 1 10 THR 10 628 628 THR THR A . n A 1 11 VAL 11 629 629 VAL VAL A . n A 1 12 LYS 12 630 630 LYS LYS A . n A 1 13 ILE 13 631 631 ILE ILE A . n A 1 14 THR 14 632 632 THR THR A . n A 1 15 ALA 15 633 633 ALA ALA A . n A 1 16 SER 16 634 634 SER SER A . n A 1 17 SER 17 635 635 SER SER A . n A 1 18 GLU 18 636 636 GLU GLU A . n A 1 19 GLU 19 637 637 GLU GLU A . n A 1 20 THR 20 638 638 THR THR A . n A 1 21 SER 21 639 639 SER SER A . n A 1 22 GLY 22 640 640 GLY GLY A . n A 1 23 GLU 23 641 641 GLU GLU A . n A 1 24 ASN 24 642 642 ASN ASN A . n A 1 25 ALA 25 643 643 ALA ALA A . n A 1 26 PRO 26 644 644 PRO PRO A . n A 1 27 ALA 27 645 645 ALA ALA A . n A 1 28 SER 28 646 646 SER SER A . n A 1 29 PHE 29 647 647 PHE PHE A . n A 1 30 ALA 30 648 648 ALA ALA A . n A 1 31 SER 31 649 649 SER SER A . n A 1 32 ASP 32 650 650 ASP ASP A . n A 1 33 GLY 33 651 651 GLY GLY A . n A 1 34 ASP 34 652 652 ASP ASP A . n A 1 35 MET 35 653 653 MET MET A . n A 1 36 ASN 36 654 654 ASN ASN A . n A 1 37 THR 37 655 655 THR THR A . n A 1 38 PHE 38 656 656 PHE PHE A . n A 1 39 TRP 39 657 657 TRP TRP A . n A 1 40 HIS 40 658 658 HIS HIS A . n A 1 41 SER 41 659 659 SER SER A . n A 1 42 LYS 42 660 660 LYS LYS A . n A 1 43 TRP 43 661 661 TRP TRP A . n A 1 44 SER 44 662 662 SER SER A . n A 1 45 SER 45 663 663 SER SER A . n A 1 46 PRO 46 664 664 PRO PRO A . n A 1 47 ALA 47 665 665 ALA ALA A . n A 1 48 HIS 48 666 666 HIS HIS A . n A 1 49 GLU 49 667 667 GLU GLU A . n A 1 50 GLY 50 668 668 GLY GLY A . n A 1 51 PRO 51 669 669 PRO PRO A . n A 1 52 HIS 52 670 670 HIS HIS A . n A 1 53 HIS 53 671 671 HIS HIS A . n A 1 54 LEU 54 672 672 LEU LEU A . n A 1 55 THR 55 673 673 THR THR A . n A 1 56 LEU 56 674 674 LEU LEU A . n A 1 57 GLU 57 675 675 GLU GLU A . n A 1 58 LEU 58 676 676 LEU LEU A . n A 1 59 ASP 59 677 677 ASP ASP A . n A 1 60 ASN 60 678 678 ASN ASN A . n A 1 61 VAL 61 679 679 VAL VAL A . n A 1 62 TYR 62 680 680 TYR TYR A . n A 1 63 GLU 63 681 681 GLU GLU A . n A 1 64 ILE 64 682 682 ILE ILE A . n A 1 65 ASN 65 683 683 ASN ASN A . n A 1 66 LYS 66 684 684 LYS LYS A . n A 1 67 VAL 67 685 685 VAL VAL A . n A 1 68 LYS 68 686 686 LYS LYS A . n A 1 69 TYR 69 687 687 TYR TYR A . n A 1 70 ALA 70 688 688 ALA ALA A . n A 1 71 PRO 71 689 689 PRO PRO A . n A 1 72 ARG 72 690 690 ARG ARG A . n A 1 73 GLN 73 691 691 GLN GLN A . n A 1 74 ASP 74 692 692 ASP ASP A . n A 1 75 SER 75 693 693 SER SER A . n A 1 76 LYS 76 694 694 LYS LYS A . n A 1 77 ASN 77 695 695 ASN ASN A . n A 1 78 GLY 78 696 696 GLY GLY A . n A 1 79 ARG 79 697 697 ARG ARG A . n A 1 80 ILE 80 698 698 ILE ILE A . n A 1 81 THR 81 699 699 THR THR A . n A 1 82 GLY 82 700 700 GLY GLY A . n A 1 83 TYR 83 701 701 TYR TYR A . n A 1 84 LYS 84 702 702 LYS LYS A . n A 1 85 VAL 85 703 703 VAL VAL A . n A 1 86 SER 86 704 704 SER SER A . n A 1 87 VAL 87 705 705 VAL VAL A . n A 1 88 SER 88 706 706 SER SER A . n A 1 89 LEU 89 707 707 LEU LEU A . n A 1 90 ASP 90 708 708 ASP ASP A . n A 1 91 GLY 91 709 709 GLY GLY A . n A 1 92 GLU 92 710 710 GLU GLU A . n A 1 93 ASN 93 711 711 ASN ASN A . n A 1 94 PHE 94 712 712 PHE PHE A . n A 1 95 THR 95 713 713 THR THR A . n A 1 96 GLU 96 714 714 GLU GLU A . n A 1 97 VAL 97 715 715 VAL VAL A . n A 1 98 LYS 98 716 716 LYS LYS A . n A 1 99 THR 99 717 717 THR THR A . n A 1 100 GLY 100 718 718 GLY GLY A . n A 1 101 THR 101 719 719 THR THR A . n A 1 102 LEU 102 720 720 LEU LEU A . n A 1 103 GLU 103 721 721 GLU GLU A . n A 1 104 ASP 104 722 722 ASP ASP A . n A 1 105 ASN 105 723 723 ASN ASN A . n A 1 106 ALA 106 724 724 ALA ALA A . n A 1 107 ALA 107 725 725 ALA ALA A . n A 1 108 ILE 108 726 726 ILE ILE A . n A 1 109 LYS 109 727 727 LYS LYS A . n A 1 110 PHE 110 728 728 PHE PHE A . n A 1 111 ILE 111 729 729 ILE ILE A . n A 1 112 GLU 112 730 730 GLU GLU A . n A 1 113 PHE 113 731 731 PHE PHE A . n A 1 114 ASP 114 732 732 ASP ASP A . n A 1 115 SER 115 733 733 SER SER A . n A 1 116 VAL 116 734 734 VAL VAL A . n A 1 117 ASP 117 735 735 ASP ASP A . n A 1 118 ALA 118 736 736 ALA ALA A . n A 1 119 LYS 119 737 737 LYS LYS A . n A 1 120 TYR 120 738 738 TYR TYR A . n A 1 121 VAL 121 739 739 VAL VAL A . n A 1 122 ARG 122 740 740 ARG ARG A . n A 1 123 LEU 123 741 741 LEU LEU A . n A 1 124 ASP 124 742 742 ASP ASP A . n A 1 125 VAL 125 743 743 VAL VAL A . n A 1 126 THR 126 744 744 THR THR A . n A 1 127 ASP 127 745 745 ASP ASP A . n A 1 128 SER 128 746 746 SER SER A . n A 1 129 VAL 129 747 747 VAL VAL A . n A 1 130 SER 130 748 748 SER SER A . n A 1 131 ASP 131 749 749 ASP ASP A . n A 1 132 GLN 132 750 750 GLN GLN A . n A 1 133 ALA 133 751 751 ALA ALA A . n A 1 134 ASN 134 752 752 ASN ASN A . n A 1 135 GLY 135 753 753 GLY GLY A . n A 1 136 ARG 136 754 754 ARG ARG A . n A 1 137 GLY 137 755 755 GLY GLY A . n A 1 138 LYS 138 756 756 LYS LYS A . n A 1 139 PHE 139 757 757 PHE PHE A . n A 1 140 ALA 140 758 758 ALA ALA A . n A 1 141 THR 141 759 759 THR THR A . n A 1 142 ALA 142 760 760 ALA ALA A . n A 1 143 ALA 143 761 761 ALA ALA A . n A 1 144 GLU 144 762 762 GLU GLU A . n A 1 145 VAL 145 763 763 VAL VAL A . n A 1 146 ASN 146 764 764 ASN ASN A . n A 1 147 VAL 147 765 765 VAL VAL A . n A 1 148 HIS 148 766 766 HIS HIS A . n A 1 149 GLY 149 767 767 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 1768 1768 CA CA A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . D 4 HOH 54 2054 2054 HOH HOH A . D 4 HOH 55 2055 2055 HOH HOH A . D 4 HOH 56 2056 2056 HOH HOH A . D 4 HOH 57 2057 2057 HOH HOH A . D 4 HOH 58 2058 2058 HOH HOH A . D 4 HOH 59 2059 2059 HOH HOH A . D 4 HOH 60 2060 2060 HOH HOH A . D 4 HOH 61 2061 2061 HOH HOH A . D 4 HOH 62 2062 2062 HOH HOH A . D 4 HOH 63 2063 2063 HOH HOH A . D 4 HOH 64 2064 2064 HOH HOH A . D 4 HOH 65 2065 2065 HOH HOH A . D 4 HOH 66 2066 2066 HOH HOH A . D 4 HOH 67 2067 2067 HOH HOH A . D 4 HOH 68 2068 2068 HOH HOH A . D 4 HOH 69 2069 2069 HOH HOH A . D 4 HOH 70 2070 2070 HOH HOH A . D 4 HOH 71 2071 2071 HOH HOH A . D 4 HOH 72 2072 2072 HOH HOH A . D 4 HOH 73 2073 2073 HOH HOH A . D 4 HOH 74 2074 2074 HOH HOH A . D 4 HOH 75 2075 2075 HOH HOH A . D 4 HOH 76 2076 2076 HOH HOH A . D 4 HOH 77 2077 2077 HOH HOH A . D 4 HOH 78 2078 2078 HOH HOH A . D 4 HOH 79 2079 2079 HOH HOH A . D 4 HOH 80 2080 2080 HOH HOH A . D 4 HOH 81 2081 2081 HOH HOH A . D 4 HOH 82 2082 2082 HOH HOH A . D 4 HOH 83 2083 2083 HOH HOH A . D 4 HOH 84 2084 2084 HOH HOH A . D 4 HOH 85 2085 2085 HOH HOH A . D 4 HOH 86 2086 2086 HOH HOH A . D 4 HOH 87 2087 2087 HOH HOH A . D 4 HOH 88 2088 2088 HOH HOH A . D 4 HOH 89 2089 2089 HOH HOH A . D 4 HOH 90 2090 2090 HOH HOH A . D 4 HOH 91 2091 2091 HOH HOH A . D 4 HOH 92 2092 2092 HOH HOH A . D 4 HOH 93 2093 2093 HOH HOH A . D 4 HOH 94 2094 2094 HOH HOH A . D 4 HOH 95 2095 2095 HOH HOH A . D 4 HOH 96 2096 2096 HOH HOH A . D 4 HOH 97 2097 2097 HOH HOH A . D 4 HOH 98 2098 2098 HOH HOH A . D 4 HOH 99 2099 2099 HOH HOH A . D 4 HOH 100 2100 2100 HOH HOH A . D 4 HOH 101 2101 2101 HOH HOH A . D 4 HOH 102 2102 2102 HOH HOH A . D 4 HOH 103 2103 2103 HOH HOH A . D 4 HOH 104 2104 2104 HOH HOH A . D 4 HOH 105 2105 2105 HOH HOH A . D 4 HOH 106 2106 2106 HOH HOH A . D 4 HOH 107 2107 2107 HOH HOH A . D 4 HOH 108 2108 2108 HOH HOH A . D 4 HOH 109 2109 2109 HOH HOH A . D 4 HOH 110 2110 2110 HOH HOH A . D 4 HOH 111 2111 2111 HOH HOH A . D 4 HOH 112 2112 2112 HOH HOH A . D 4 HOH 113 2113 2113 HOH HOH A . D 4 HOH 114 2114 2114 HOH HOH A . D 4 HOH 115 2115 2115 HOH HOH A . D 4 HOH 116 2116 2116 HOH HOH A . D 4 HOH 117 2117 2117 HOH HOH A . D 4 HOH 118 2118 2118 HOH HOH A . D 4 HOH 119 2119 2119 HOH HOH A . D 4 HOH 120 2120 2120 HOH HOH A . D 4 HOH 121 2121 2121 HOH HOH A . D 4 HOH 122 2122 2122 HOH HOH A . D 4 HOH 123 2123 2123 HOH HOH A . D 4 HOH 124 2124 2124 HOH HOH A . D 4 HOH 125 2125 2125 HOH HOH A . D 4 HOH 126 2126 2126 HOH HOH A . D 4 HOH 127 2127 2127 HOH HOH A . D 4 HOH 128 2128 2128 HOH HOH A . D 4 HOH 129 2129 2129 HOH HOH A . D 4 HOH 130 2130 2130 HOH HOH A . D 4 HOH 131 2131 2131 HOH HOH A . D 4 HOH 132 2132 2132 HOH HOH A . D 4 HOH 133 2133 2133 HOH HOH A . D 4 HOH 134 2134 2134 HOH HOH A . D 4 HOH 135 2135 2135 HOH HOH A . D 4 HOH 136 2136 2136 HOH HOH A . D 4 HOH 137 2137 2137 HOH HOH A . D 4 HOH 138 2138 2138 HOH HOH A . D 4 HOH 139 2139 2139 HOH HOH A . D 4 HOH 140 2140 2140 HOH HOH A . D 4 HOH 141 2141 2141 HOH HOH A . D 4 HOH 142 2142 2142 HOH HOH A . D 4 HOH 143 2143 2143 HOH HOH A . D 4 HOH 144 2144 2144 HOH HOH A . D 4 HOH 145 2145 2145 HOH HOH A . D 4 HOH 146 2146 2146 HOH HOH A . D 4 HOH 147 2147 2147 HOH HOH A . D 4 HOH 148 2148 2148 HOH HOH A . D 4 HOH 149 2149 2149 HOH HOH A . D 4 HOH 150 2150 2150 HOH HOH A . D 4 HOH 151 2151 2151 HOH HOH A . D 4 HOH 152 2152 2152 HOH HOH A . D 4 HOH 153 2153 2153 HOH HOH A . D 4 HOH 154 2154 2154 HOH HOH A . D 4 HOH 155 2155 2155 HOH HOH A . D 4 HOH 156 2156 2156 HOH HOH A . D 4 HOH 157 2157 2157 HOH HOH A . D 4 HOH 158 2158 2158 HOH HOH A . D 4 HOH 159 2159 2159 HOH HOH A . D 4 HOH 160 2160 2160 HOH HOH A . D 4 HOH 161 2161 2161 HOH HOH A . D 4 HOH 162 2162 2162 HOH HOH A . D 4 HOH 163 2163 2163 HOH HOH A . D 4 HOH 164 2164 2164 HOH HOH A . D 4 HOH 165 2165 2165 HOH HOH A . D 4 HOH 166 2166 2166 HOH HOH A . D 4 HOH 167 2167 2167 HOH HOH A . D 4 HOH 168 2168 2168 HOH HOH A . D 4 HOH 169 2169 2169 HOH HOH A . D 4 HOH 170 2170 2170 HOH HOH A . D 4 HOH 171 2171 2171 HOH HOH A . D 4 HOH 172 2172 2172 HOH HOH A . D 4 HOH 173 2173 2173 HOH HOH A . D 4 HOH 174 2174 2174 HOH HOH A . D 4 HOH 175 2175 2175 HOH HOH A . D 4 HOH 176 2176 2176 HOH HOH A . D 4 HOH 177 2177 2177 HOH HOH A . D 4 HOH 178 2178 2178 HOH HOH A . D 4 HOH 179 2179 2179 HOH HOH A . D 4 HOH 180 2180 2180 HOH HOH A . D 4 HOH 181 2181 2181 HOH HOH A . D 4 HOH 182 2182 2182 HOH HOH A . D 4 HOH 183 2183 2183 HOH HOH A . D 4 HOH 184 2184 2184 HOH HOH A . D 4 HOH 185 2185 2185 HOH HOH A . D 4 HOH 186 2186 2186 HOH HOH A . D 4 HOH 187 2187 2187 HOH HOH A . D 4 HOH 188 2188 2188 HOH HOH A . D 4 HOH 189 2189 2189 HOH HOH A . D 4 HOH 190 2190 2190 HOH HOH A . D 4 HOH 191 2191 2191 HOH HOH A . D 4 HOH 192 2192 2192 HOH HOH A . D 4 HOH 193 2193 2193 HOH HOH A . D 4 HOH 194 2194 2194 HOH HOH A . D 4 HOH 195 2195 2195 HOH HOH A . D 4 HOH 196 2196 2196 HOH HOH A . D 4 HOH 197 2197 2197 HOH HOH A . D 4 HOH 198 2198 2198 HOH HOH A . D 4 HOH 199 2199 2199 HOH HOH A . D 4 HOH 200 2200 2200 HOH HOH A . D 4 HOH 201 2201 2201 HOH HOH A . D 4 HOH 202 2202 2202 HOH HOH A . D 4 HOH 203 2203 2203 HOH HOH A . D 4 HOH 204 2204 2204 HOH HOH A . D 4 HOH 205 2205 2205 HOH HOH A . D 4 HOH 206 2206 2206 HOH HOH A . D 4 HOH 207 2207 2207 HOH HOH A . D 4 HOH 208 2208 2208 HOH HOH A . D 4 HOH 209 2209 2209 HOH HOH A . # _pdbx_molecule_features.prd_id PRD_900125 _pdbx_molecule_features.name 'H type 2 antigen, alpha anomer' _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class Antigen _pdbx_molecule_features.details oligosaccharide # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900125 _pdbx_molecule.asym_id B # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 2070 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A PHE 29 ? A PHE 647 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 OD2 ? A ASP 32 ? A ASP 650 ? 1_555 87.0 ? 2 O ? A PHE 29 ? A PHE 647 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 O ? A ASP 32 ? A ASP 650 ? 1_555 89.0 ? 3 OD2 ? A ASP 32 ? A ASP 650 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 O ? A ASP 32 ? A ASP 650 ? 1_555 63.6 ? 4 O ? A PHE 29 ? A PHE 647 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 O ? A ASP 34 ? A ASP 652 ? 1_555 171.6 ? 5 OD2 ? A ASP 32 ? A ASP 650 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 O ? A ASP 34 ? A ASP 652 ? 1_555 92.4 ? 6 O ? A ASP 32 ? A ASP 650 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 O ? A ASP 34 ? A ASP 652 ? 1_555 98.2 ? 7 O ? A PHE 29 ? A PHE 647 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 OG1 ? A THR 37 ? A THR 655 ? 1_555 92.2 ? 8 OD2 ? A ASP 32 ? A ASP 650 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 OG1 ? A THR 37 ? A THR 655 ? 1_555 77.8 ? 9 O ? A ASP 32 ? A ASP 650 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 OG1 ? A THR 37 ? A THR 655 ? 1_555 141.3 ? 10 O ? A ASP 34 ? A ASP 652 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 OG1 ? A THR 37 ? A THR 655 ? 1_555 79.5 ? 11 O ? A PHE 29 ? A PHE 647 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 O ? A THR 37 ? A THR 655 ? 1_555 101.5 ? 12 OD2 ? A ASP 32 ? A ASP 650 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 O ? A THR 37 ? A THR 655 ? 1_555 145.9 ? 13 O ? A ASP 32 ? A ASP 650 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 O ? A THR 37 ? A THR 655 ? 1_555 148.2 ? 14 O ? A ASP 34 ? A ASP 652 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 O ? A THR 37 ? A THR 655 ? 1_555 74.5 ? 15 OG1 ? A THR 37 ? A THR 655 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 O ? A THR 37 ? A THR 655 ? 1_555 69.0 ? 16 O ? A PHE 29 ? A PHE 647 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 O ? A ALA 143 ? A ALA 761 ? 1_555 78.5 ? 17 OD2 ? A ASP 32 ? A ASP 650 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 O ? A ALA 143 ? A ALA 761 ? 1_555 135.8 ? 18 O ? A ASP 32 ? A ASP 650 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 O ? A ALA 143 ? A ALA 761 ? 1_555 74.5 ? 19 O ? A ASP 34 ? A ASP 652 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 O ? A ALA 143 ? A ALA 761 ? 1_555 107.4 ? 20 OG1 ? A THR 37 ? A THR 655 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 O ? A ALA 143 ? A ALA 761 ? 1_555 143.4 ? 21 O ? A THR 37 ? A THR 655 ? 1_555 CA ? C CA . ? A CA 1768 ? 1_555 O ? A ALA 143 ? A ALA 761 ? 1_555 78.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-16 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' chem_comp 3 4 'Structure model' entity 4 4 'Structure model' entity_name_com 5 4 'Structure model' pdbx_branch_scheme 6 4 'Structure model' pdbx_chem_comp_identifier 7 4 'Structure model' pdbx_database_status 8 4 'Structure model' pdbx_entity_branch 9 4 'Structure model' pdbx_entity_branch_descriptor 10 4 'Structure model' pdbx_entity_branch_link 11 4 'Structure model' pdbx_entity_branch_list 12 4 'Structure model' pdbx_entity_nonpoly 13 4 'Structure model' pdbx_molecule_features 14 4 'Structure model' pdbx_nonpoly_scheme 15 4 'Structure model' pdbx_struct_assembly_gen 16 4 'Structure model' pdbx_struct_conn_angle 17 4 'Structure model' pdbx_struct_special_symmetry 18 4 'Structure model' struct_asym 19 4 'Structure model' struct_conn 20 4 'Structure model' struct_conn_type 21 4 'Structure model' struct_site 22 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.B_iso_or_equiv' 2 4 'Structure model' '_atom_site.Cartn_x' 3 4 'Structure model' '_atom_site.Cartn_y' 4 4 'Structure model' '_atom_site.Cartn_z' 5 4 'Structure model' '_atom_site.auth_asym_id' 6 4 'Structure model' '_atom_site.auth_atom_id' 7 4 'Structure model' '_atom_site.auth_comp_id' 8 4 'Structure model' '_atom_site.auth_seq_id' 9 4 'Structure model' '_atom_site.label_asym_id' 10 4 'Structure model' '_atom_site.label_atom_id' 11 4 'Structure model' '_atom_site.label_comp_id' 12 4 'Structure model' '_atom_site.label_entity_id' 13 4 'Structure model' '_atom_site.type_symbol' 14 4 'Structure model' '_chem_comp.name' 15 4 'Structure model' '_chem_comp.type' 16 4 'Structure model' '_pdbx_database_status.status_code_sf' 17 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 24 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 25 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 26 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 27 4 'Structure model' '_pdbx_struct_conn_angle.value' 28 4 'Structure model' '_pdbx_struct_special_symmetry.label_asym_id' 29 4 'Structure model' '_struct_conn.conn_type_id' 30 4 'Structure model' '_struct_conn.id' 31 4 'Structure model' '_struct_conn.pdbx_dist_value' 32 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 33 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 34 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 35 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 36 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 37 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 38 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 39 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 40 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 41 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 42 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 43 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 44 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 45 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 46 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 47 4 'Structure model' '_struct_conn_type.id' # _software.name REFMAC _software.classification refinement _software.version 5.2.0019 _software.citation_id ? _software.pdbx_ordinal 1 # _pdbx_database_remark.id 700 _pdbx_database_remark.text ; SHEET THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW, TWO SHEETS ARE DEFINED. ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 2015 ? ? O A HOH 2118 ? ? 1.87 2 1 CD2 A HIS 671 ? ? O A HOH 2094 ? ? 2.06 3 1 O A HOH 2105 ? ? O A HOH 2156 ? ? 2.15 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 2072 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 2072 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 8_665 _pdbx_validate_symm_contact.dist 0.83 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 754 ? ? CZ A ARG 754 ? ? NH1 A ARG 754 ? ? 115.81 120.30 -4.49 0.50 N 2 1 NE A ARG 754 ? ? CZ A ARG 754 ? ? NH2 A ARG 754 ? ? 125.55 120.30 5.25 0.50 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 659 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -49.35 _pdbx_validate_torsion.psi 156.63 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 2031 ? 7.02 . 2 1 O ? A HOH 2033 ? . 7.21 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 619 ? A GLY 1 2 1 Y 1 A ILE 620 ? A ILE 2 3 1 Y 1 A ASP 621 ? A ASP 3 4 1 Y 1 A PRO 622 ? A PRO 4 5 1 Y 1 A PHE 623 ? A PHE 5 6 1 Y 1 A THR 624 ? A THR 6 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NDG 1 B NDG 1 A NDG 1769 n B 2 GAL 2 B GAL 2 A GAL 1770 n B 2 FUC 3 B FUC 3 A FUC 1771 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 LFucpa FUC 'COMMON NAME' GMML 1.0 a-L-fucopyranose FUC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-L-Fucp FUC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Fuc GAL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGalpb GAL 'COMMON NAME' GMML 1.0 b-D-galactopyranose GAL 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Galp GAL 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Gal NDG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAca NDG 'COMMON NAME' GMML 1.0 N-acetyl-a-D-glucopyranosamine NDG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-GlcpNAc NDG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 LFucpa1-2DGalpb1-4DGlcpNAca1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/3,3,2/[a2122h-1a_1-5_2*NCC/3=O][a2112h-1b_1-5][a1221m-1a_1-5]/1-2-3/a4-b1_b2-c1' WURCS PDB2Glycan 1.1.0 3 2 '[][a-D-GlcpNAc]{[(4+1)][b-D-Galp]{[(2+1)][a-L-Fucp]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 GAL C1 O1 1 NDG O4 HO4 sing ? 2 2 3 FUC C1 O1 2 GAL O2 HO2 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NDG 1 n 2 GAL 2 n 2 FUC 3 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CALCIUM ION' CA 4 water HOH #