data_2JS2 # _entry.id 2JS2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JS2 pdb_00002js2 10.2210/pdb2js2/pdb RCSB RCSB100218 ? ? WWPDB D_1000100218 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2JS0 _pdbx_database_related.details ;'Specificity Determinants of a Novel Nck Interaction with the Juxtamembrane Domain of the Epidermal Growth Factor Receptor' ; _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JS2 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-06-29 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hake, M.J.' 1 'Choowongkomon, K.' 2 'Carlin, C.R.' 3 'Sonnichsen, F.D.' 4 # _citation.id primary _citation.title 'Specificity determinants of a novel Nck interaction with the juxtamembrane domain of the epidermal growth factor receptor.' _citation.journal_abbrev Biochemistry _citation.journal_volume 47 _citation.page_first 3096 _citation.page_last 3108 _citation.year 2008 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18269246 _citation.pdbx_database_id_DOI 10.1021/bi701549a # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hake, M.J.' 1 ? primary 'Choowongkomon, K.' 2 ? primary 'Kostenko, O.' 3 ? primary 'Carlin, C.R.' 4 ? primary 'Sonnichsen, F.D.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cytoplasmic protein NCK1' _entity.formula_weight 7460.377 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 1' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'NCK adaptor protein 1, SH2/SH3 adaptor protein NCK-alpha' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNS _entity_poly.pdbx_seq_one_letter_code_can GSMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 ALA n 1 5 GLU n 1 6 GLU n 1 7 VAL n 1 8 VAL n 1 9 VAL n 1 10 VAL n 1 11 ALA n 1 12 LYS n 1 13 PHE n 1 14 ASP n 1 15 TYR n 1 16 VAL n 1 17 ALA n 1 18 GLN n 1 19 GLN n 1 20 GLU n 1 21 GLN n 1 22 GLU n 1 23 LEU n 1 24 ASP n 1 25 ILE n 1 26 LYS n 1 27 LYS n 1 28 ASN n 1 29 GLU n 1 30 ARG n 1 31 LEU n 1 32 TRP n 1 33 LEU n 1 34 LEU n 1 35 ASP n 1 36 ASP n 1 37 SER n 1 38 LYS n 1 39 SER n 1 40 TRP n 1 41 TRP n 1 42 ARG n 1 43 VAL n 1 44 ARG n 1 45 ASN n 1 46 SER n 1 47 MET n 1 48 ASN n 1 49 LYS n 1 50 THR n 1 51 GLY n 1 52 PHE n 1 53 VAL n 1 54 PRO n 1 55 SER n 1 56 ASN n 1 57 TYR n 1 58 VAL n 1 59 GLU n 1 60 ARG n 1 61 LYS n 1 62 ASN n 1 63 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'NCK1, NCK' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pGEV2 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NCK1_HUMAN _struct_ref.pdbx_db_accession P16333 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNS _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JS2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 63 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16333 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 61 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 63 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JS2 GLY A 1 ? UNP P16333 ? ? 'expression tag' 1 1 1 2JS2 SER A 2 ? UNP P16333 ? ? 'expression tag' 2 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' 1 3 1 '2D 1H-1H NOESY' 1 4 1 '2D 1H-15N HSQC' 1 5 1 '2D 1H-13C HSQC' 1 6 1 '3D HNCO' 1 7 1 '3D HNCACB' 1 8 1 '3D CBCA(CO)NH' 1 9 1 '3D H(CCO)NH' 1 10 1 '3D HCCH-TOCSY' 1 11 1 '3D HNHB' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 6.1 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.5-1.0 mM [U-99% 13C; U-99% 15N] Nck1-1, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 1 mM EDTA, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 500 Varian INOVA 2 'Varian INOVA' 600 Bruker AVANCE 3 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2JS2 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JS2 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JS2 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Johnson, One Moon Scientific' 'data analysis' NMRView 5.2.1 2 'Johnson, One Moon Scientific' 'peak picking' NMRView 5.2.1 3 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView 5.2.1 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 5 'Brunger, Adams, Clore, Gros, Nilges and Read' 'water refinement' CNS 1.1 6 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JS2 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JS2 _struct.title 'Solution structure of first SH3 domain of adaptor Nck' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JS2 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'SH3 domain, adaptor, signaling, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 50 ? VAL A 53 ? THR A 50 VAL A 53 A 2 TRP A 41 ? ARG A 44 ? TRP A 41 ARG A 44 A 3 ARG A 30 ? ASP A 35 ? ARG A 30 ASP A 35 A 4 VAL A 8 ? ALA A 11 ? VAL A 8 ALA A 11 A 5 VAL A 58 ? ARG A 60 ? VAL A 58 ARG A 60 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 53 ? O VAL A 53 N TRP A 41 ? N TRP A 41 A 2 3 O ARG A 44 ? O ARG A 44 N TRP A 32 ? N TRP A 32 A 3 4 O LEU A 31 ? O LEU A 31 N VAL A 9 ? N VAL A 9 A 4 5 N VAL A 10 ? N VAL A 10 O GLU A 59 ? O GLU A 59 # _atom_sites.entry_id 2JS2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 SER 63 63 63 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-02-26 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_spectrometer 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Nck1-1 0.5 mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate' 20 mM ? 1 'sodium chloride' 100 mM ? 1 'sodium azide' 2 mM ? 1 EDTA 1 mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2JS2 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 812 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 222 _pdbx_nmr_constraints.NOE_long_range_total_count 333 _pdbx_nmr_constraints.NOE_medium_range_total_count 68 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 189 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 15 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 37 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 37 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 OE1 A GLU 20 ? ? HZ2 A LYS 49 ? ? 1.57 2 9 HZ1 A LYS 12 ? ? OE2 A GLU 59 ? ? 1.57 3 11 OE1 A GLU 6 ? ? HH22 A ARG 44 ? ? 1.60 4 16 OE1 A GLU 20 ? ? HZ1 A LYS 49 ? ? 1.55 5 20 OD1 A ASP 14 ? ? HZ3 A LYS 26 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 34 ? ? -108.30 -61.46 2 1 ASN A 48 ? ? 48.71 28.77 3 2 SER A 39 ? ? 42.18 -93.17 4 2 ARG A 60 ? ? -110.03 -167.07 5 3 ASP A 36 ? ? -99.98 59.61 6 3 LYS A 38 ? ? -147.99 -154.87 7 3 ASN A 48 ? ? 74.99 -20.72 8 3 ASN A 62 ? ? 74.17 143.39 9 4 ARG A 60 ? ? -92.25 -120.10 10 5 ALA A 4 ? ? -87.92 -70.87 11 5 GLU A 5 ? ? -160.05 98.72 12 5 SER A 39 ? ? 67.92 -162.07 13 5 ARG A 60 ? ? -75.03 -151.59 14 5 ASN A 62 ? ? -171.13 116.50 15 6 LYS A 38 ? ? -160.43 -84.35 16 6 TRP A 40 ? ? 66.18 100.52 17 6 ARG A 60 ? ? -83.43 -139.04 18 7 SER A 39 ? ? 66.68 88.69 19 7 TRP A 40 ? ? 60.79 -172.47 20 7 ASN A 62 ? ? 72.77 158.76 21 8 ALA A 4 ? ? 58.41 86.30 22 8 LYS A 38 ? ? -176.46 -126.70 23 8 TRP A 40 ? ? 66.31 93.08 24 9 SER A 2 ? ? -119.75 79.82 25 9 MET A 3 ? ? -146.56 35.79 26 9 SER A 39 ? ? 51.21 -123.79 27 9 ASN A 48 ? ? 74.88 -17.06 28 10 MET A 3 ? ? -83.03 -71.17 29 10 ALA A 4 ? ? -166.12 -64.45 30 10 VAL A 7 ? ? -67.66 99.70 31 10 ASN A 28 ? ? 70.26 35.07 32 10 TRP A 40 ? ? 70.45 90.99 33 11 SER A 2 ? ? -152.25 -59.92 34 11 MET A 3 ? ? 62.84 93.18 35 11 GLN A 18 ? ? -82.54 -70.29 36 11 SER A 39 ? ? 69.57 -73.23 37 12 LYS A 38 ? ? -179.50 -74.76 38 12 ASN A 48 ? ? 49.80 26.26 39 13 SER A 2 ? ? -175.20 -171.22 40 13 MET A 3 ? ? -63.83 98.71 41 13 ASP A 36 ? ? -113.34 74.41 42 13 SER A 37 ? ? -65.91 5.09 43 13 LYS A 38 ? ? 76.37 -62.60 44 13 TRP A 40 ? ? 71.28 133.97 45 13 ASN A 48 ? ? 74.04 -6.36 46 14 MET A 3 ? ? 70.55 -60.70 47 15 ALA A 4 ? ? -149.48 -64.73 48 15 LYS A 38 ? ? -176.27 -74.66 49 15 TRP A 40 ? ? 64.32 97.72 50 15 ASN A 62 ? ? -151.61 68.87 51 16 ALA A 4 ? ? -177.83 -48.34 52 16 VAL A 7 ? ? -69.05 95.30 53 16 SER A 39 ? ? 57.17 80.43 54 16 TRP A 40 ? ? 65.43 -175.39 55 17 LYS A 38 ? ? -172.52 -91.88 56 17 ASN A 62 ? ? 76.29 88.68 57 18 ASP A 36 ? ? -103.15 64.85 58 18 SER A 37 ? ? -67.52 5.34 59 18 LYS A 38 ? ? 73.59 -69.63 60 18 TRP A 40 ? ? 70.92 113.33 61 18 ARG A 60 ? ? -106.92 -159.10 62 19 ASN A 28 ? ? 48.95 28.83 63 19 SER A 39 ? ? 68.17 -83.36 64 19 ASN A 62 ? ? -86.72 -106.36 65 20 ALA A 4 ? ? -144.69 -74.33 66 20 ASP A 36 ? ? -119.28 66.03 67 20 LYS A 38 ? ? -172.66 -84.74 68 20 TRP A 40 ? ? 65.35 99.12 #