data_2JTE # _entry.id 2JTE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JTE pdb_00002jte 10.2210/pdb2jte/pdb RCSB RCSB100266 ? ? WWPDB D_1000100266 ? ? # _pdbx_database_related.db_id 15407 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JTE _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-07-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'van Nuland, N.A.J.' 1 'Ortega, R.J.' 2 'Romero Romero, M.' 3 'Ab, E.' 4 'Ora, A.' 5 'Lopez, M.O.' 6 'Azuaga, A.I.' 7 # _citation.id primary _citation.title 'The high resolution NMR structure of the third SH3 domain of CD2AP.' _citation.journal_abbrev J.Biomol.Nmr _citation.journal_volume 39 _citation.page_first 331 _citation.page_last 336 _citation.year 2007 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17922258 _citation.pdbx_database_id_DOI 10.1007/s10858-007-9201-7 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ortega Roldan, J.L.' 1 ? primary 'Romero Romero, M.L.' 2 ? primary 'Ora, A.' 3 ? primary 'Ab, E.' 4 ? primary 'Lopez Mayorga, O.' 5 ? primary 'Azuaga, A.I.' 6 ? primary 'van Nuland, N.A.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'CD2-associated protein' _entity.formula_weight 7146.910 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain, residues 270-329' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Mesenchyme-to-epithelium transition protein with SH3 domains 1, METS-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GAMGAKEYCRTLFPYTGTNEDELTFREGEIIHLISKETGEAGWWKGELNGKEGVFPDNFAVQIS _entity_poly.pdbx_seq_one_letter_code_can GAMGAKEYCRTLFPYTGTNEDELTFREGEIIHLISKETGEAGWWKGELNGKEGVFPDNFAVQIS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 ALA n 1 6 LYS n 1 7 GLU n 1 8 TYR n 1 9 CYS n 1 10 ARG n 1 11 THR n 1 12 LEU n 1 13 PHE n 1 14 PRO n 1 15 TYR n 1 16 THR n 1 17 GLY n 1 18 THR n 1 19 ASN n 1 20 GLU n 1 21 ASP n 1 22 GLU n 1 23 LEU n 1 24 THR n 1 25 PHE n 1 26 ARG n 1 27 GLU n 1 28 GLY n 1 29 GLU n 1 30 ILE n 1 31 ILE n 1 32 HIS n 1 33 LEU n 1 34 ILE n 1 35 SER n 1 36 LYS n 1 37 GLU n 1 38 THR n 1 39 GLY n 1 40 GLU n 1 41 ALA n 1 42 GLY n 1 43 TRP n 1 44 TRP n 1 45 LYS n 1 46 GLY n 1 47 GLU n 1 48 LEU n 1 49 ASN n 1 50 GLY n 1 51 LYS n 1 52 GLU n 1 53 GLY n 1 54 VAL n 1 55 PHE n 1 56 PRO n 1 57 ASP n 1 58 ASN n 1 59 PHE n 1 60 ALA n 1 61 VAL n 1 62 GLN n 1 63 ILE n 1 64 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'Cd2ap, Mets1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pETM-11 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CD2AP_MOUSE _struct_ref.pdbx_db_accession Q9JLQ0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AKEYCRTLFPYTGTNEDELTFREGEIIHLISKETGEAGWWKGELNGKEGVFPDNFAVQIS _struct_ref.pdbx_align_begin 270 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JTE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9JLQ0 _struct_ref_seq.db_align_beg 270 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 329 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 64 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JTE GLY A 1 ? UNP Q9JLQ0 ? ? 'expression tag' 1 1 1 2JTE ALA A 2 ? UNP Q9JLQ0 ? ? 'expression tag' 2 2 1 2JTE MET A 3 ? UNP Q9JLQ0 ? ? 'expression tag' 3 3 1 2JTE GLY A 4 ? UNP Q9JLQ0 ? ? 'expression tag' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCACB' 1 4 1 '3D HNCO' 1 5 1 '3D HBHA(CO)NH' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-15N TOCSY' 1 9 1 '3D 1H-15N NOESY' 1 10 2 '2D 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 2.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM SH3-C, 1 mM [U-98% 15N] SH3-C, 1 mM [U-98% 13C; U-98% 15N] SH3-C, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM SH3-C, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian 'Uniform NMR System' 1 'Varian Uniform NMR System' 800 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2JTE _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JTE _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JTE _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JTE _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JTE _struct.title 'Third SH3 domain of CD2AP' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JTE _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'protein, SH3 domain, Coiled coil, Cytoplasm, Phosphorylation, SH3-binding, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 51 ? PRO A 56 ? LYS A 51 PRO A 56 A 2 TRP A 43 ? LEU A 48 ? TRP A 43 LEU A 48 A 3 ILE A 30 ? SER A 35 ? ILE A 30 SER A 35 A 4 GLU A 7 ? THR A 11 ? GLU A 7 THR A 11 A 5 ALA A 60 ? SER A 64 ? ALA A 60 SER A 64 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 55 ? O PHE A 55 N TRP A 44 ? N TRP A 44 A 2 3 O LYS A 45 ? O LYS A 45 N SER A 35 ? N SER A 35 A 3 4 O ILE A 31 ? O ILE A 31 N CYS A 9 ? N CYS A 9 A 4 5 N ARG A 10 ? N ARG A 10 O VAL A 61 ? O VAL A 61 # _atom_sites.entry_id 2JTE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 SER 64 64 64 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-12-11 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id SH3-C-1 1 mM ? 1 SH3-C-2 1 mM '[U-98% 15N]' 1 SH3-C-3 1 mM '[U-98% 13C; U-98% 15N]' 1 SH3-C 1 mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2JTE _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1041 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 241 _pdbx_nmr_constraints.NOE_long_range_total_count 394 _pdbx_nmr_constraints.NOE_medium_range_total_count 109 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 297 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 H1 A GLY 1 ? ? OE1 A GLU 37 ? ? 1.58 2 12 HH A TYR 15 ? ? OE1 A GLU 22 ? ? 1.60 3 20 H3 A GLY 1 ? ? OE1 A GLU 37 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 6 ? ? 80.97 75.50 2 3 ALA A 2 ? ? 42.95 -79.03 3 3 ALA A 5 ? ? -95.67 -153.95 4 4 ALA A 5 ? ? -91.02 -68.64 5 5 ALA A 5 ? ? 68.41 -61.58 6 6 LYS A 6 ? ? -144.05 25.17 7 7 MET A 3 ? ? 60.13 80.92 8 9 ARG A 26 ? ? -109.84 -167.41 9 10 ALA A 2 ? ? 51.85 -163.11 10 11 ALA A 5 ? ? -131.42 -55.10 11 11 ASP A 57 ? ? -68.26 1.43 12 12 ALA A 5 ? ? -82.99 -78.45 13 13 LYS A 6 ? ? -110.98 76.37 14 15 MET A 3 ? ? -166.85 89.99 15 15 LYS A 6 ? ? 66.55 97.56 16 18 ALA A 5 ? ? -152.18 -73.23 #