data_2JTM # _entry.id 2JTM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JTM pdb_00002jtm 10.2210/pdb2jtm/pdb RCSB RCSB100274 ? ? WWPDB D_1000100274 ? ? BMRB 15415 ? ? # _pdbx_database_related.db_id 15415 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JTM _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-08-03 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Feng, Y.' 1 'Guo, L.' 2 'Huang, L.' 3 'Wang, J.' 4 # _citation.id primary _citation.title 'Biochemical and structural characterization of Cren7, a novel chromatin protein conserved among Crenarchaea' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 36 _citation.page_first 1129 _citation.page_last 1137 _citation.year 2008 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18096617 _citation.pdbx_database_id_DOI 10.1093/nar/gkm1128 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guo, L.' 1 ? primary 'Feng, Y.' 2 ? primary 'Zhang, Z.' 3 ? primary 'Yao, H.' 4 ? primary 'Luo, Y.' 5 ? primary 'Wang, J.' 6 ? primary 'Huang, L.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative uncharacterized protein' _entity.formula_weight 6677.914 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Sso6901 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI _entity_poly.pdbx_seq_one_letter_code_can MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 LYS n 1 6 LYS n 1 7 PRO n 1 8 VAL n 1 9 LYS n 1 10 VAL n 1 11 LYS n 1 12 THR n 1 13 PRO n 1 14 ALA n 1 15 GLY n 1 16 LYS n 1 17 GLU n 1 18 ALA n 1 19 GLU n 1 20 LEU n 1 21 VAL n 1 22 PRO n 1 23 GLU n 1 24 LYS n 1 25 VAL n 1 26 TRP n 1 27 ALA n 1 28 LEU n 1 29 ALA n 1 30 PRO n 1 31 LYS n 1 32 GLY n 1 33 ARG n 1 34 LYS n 1 35 GLY n 1 36 VAL n 1 37 LYS n 1 38 ILE n 1 39 GLY n 1 40 LEU n 1 41 PHE n 1 42 LYS n 1 43 ASP n 1 44 PRO n 1 45 GLU n 1 46 THR n 1 47 GLY n 1 48 LYS n 1 49 TYR n 1 50 PHE n 1 51 ARG n 1 52 HIS n 1 53 LYS n 1 54 LEU n 1 55 PRO n 1 56 ASP n 1 57 ASP n 1 58 TYR n 1 59 PRO n 1 60 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Sulfolobus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sulfolobus solfataricus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET30a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q97ZE3_SULSO _struct_ref.pdbx_db_accession Q97ZE3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JTM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 60 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q97ZE3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 60 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 60 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D DQF-COSY' 1 3 1 '2D 1H-1H NOESY' 1 4 2 '2D 1H-15N HSQC' 1 5 2 '2D 1H-13C HSQC' 1 6 2 '3D CBCA(CO)NH' 1 7 2 '3D HNCACB' 1 8 2 '3D HBHA(CO)NH' 1 9 2 '3D HNCO' 1 10 2 '3D HN(CA)CO' 1 11 2 '3D 1H-15N TOCSY' 1 12 2 '3D HCCH-COSY' 1 13 2 '3D CCH-TOCSY' 1 14 2 '3D 1H-15N NOESY' 1 15 2 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.05 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.0-2.0mM Sso6901, 0.01 % DSS, 50mM potassium phosphate, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1.0-2.0mM [U-13C; U-15N] Sso6901, 0.01 % DSS, 50mM potassium phosphate, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DMX' # _pdbx_nmr_refine.entry_id 2JTM _pdbx_nmr_refine.method 'molecular dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JTM _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JTM _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection XwinNMR ? 1 'Accelrys Software Inc.' processing Felix ? 2 'Accelrys Software Inc.' 'chemical shift assignment' Felix ? 3 'Accelrys Software Inc.' 'peak picking' Felix ? 4 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JTM _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JTM _struct.title 'Solution structure of Sso6901 from Sulfolobus solfataricus P2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JTM _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'SH3-like, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 8 ? LYS A 11 ? VAL A 8 LYS A 11 A 2 GLU A 17 ? LEU A 20 ? GLU A 17 LEU A 20 B 1 LYS A 24 ? LEU A 28 ? LYS A 24 LEU A 28 B 2 VAL A 36 ? LYS A 42 ? VAL A 36 LYS A 42 B 3 TYR A 49 ? LEU A 54 ? TYR A 49 LEU A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 10 ? N VAL A 10 O ALA A 18 ? O ALA A 18 B 1 2 N LEU A 28 ? N LEU A 28 O VAL A 36 ? O VAL A 36 B 2 3 N PHE A 41 ? N PHE A 41 O PHE A 50 ? O PHE A 50 # _atom_sites.entry_id 2JTM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 ILE 60 60 60 ILE ILE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-29 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Sso6901 1.0 mM ? 1 DSS 0.01 % ? 1 'potassium phosphate' 50 mM ? 1 Sso6901 1.0 mM '[U-13C; U-15N]' 2 DSS 0.01 % ? 2 'potassium phosphate' 50 mM ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 43 ? ? H A THR 46 ? ? 1.58 2 1 HZ1 A LYS 5 ? ? OE1 A GLU 23 ? ? 1.60 3 2 HZ2 A LYS 11 ? ? OE2 A GLU 17 ? ? 1.60 4 3 HZ3 A LYS 11 ? ? OE2 A GLU 17 ? ? 1.60 5 6 HZ1 A LYS 11 ? ? OE2 A GLU 17 ? ? 1.60 6 8 HZ3 A LYS 16 ? ? OE2 A GLU 45 ? ? 1.56 7 10 HZ1 A LYS 9 ? ? OE2 A GLU 19 ? ? 1.57 8 10 HZ3 A LYS 34 ? ? OD1 A ASP 56 ? ? 1.60 9 15 HZ1 A LYS 11 ? ? OE2 A GLU 17 ? ? 1.60 10 17 OD1 A ASP 43 ? ? H A THR 46 ? ? 1.59 11 20 HZ2 A LYS 16 ? ? OE2 A GLU 45 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 33 ? ? -118.60 -167.54 2 2 LYS A 31 ? ? -124.35 -142.53 3 3 SER A 2 ? ? 74.05 116.22 4 3 LYS A 31 ? ? 71.67 107.99 5 4 SER A 2 ? ? 54.79 82.61 6 4 LYS A 31 ? ? -160.04 -63.90 7 5 LYS A 31 ? ? 57.37 -54.69 8 7 SER A 2 ? ? -155.10 -54.93 9 7 LYS A 5 ? ? 57.37 -162.18 10 7 ARG A 33 ? ? 70.97 -66.94 11 7 LYS A 34 ? ? 179.55 -47.43 12 8 SER A 3 ? ? -146.29 44.48 13 9 LYS A 5 ? ? 61.19 -162.20 14 9 LYS A 31 ? ? -169.85 -64.81 15 10 LYS A 5 ? ? 67.62 -178.90 16 11 SER A 2 ? ? 62.41 74.44 17 11 LYS A 31 ? ? 175.39 148.19 18 12 SER A 3 ? ? -151.91 79.92 19 12 LYS A 31 ? ? 169.69 119.88 20 13 LYS A 31 ? ? -171.68 -65.92 21 13 ARG A 33 ? ? -153.43 37.66 22 13 LYS A 34 ? ? 70.72 -55.04 23 14 SER A 2 ? ? 64.86 88.77 24 14 ARG A 33 ? ? -116.47 -72.83 25 16 SER A 2 ? ? 62.67 -158.64 26 16 LYS A 5 ? ? 55.68 73.43 27 16 LYS A 31 ? ? 177.92 -64.52 28 16 ARG A 33 ? ? -169.91 -79.23 29 16 LYS A 34 ? ? -172.11 -56.13 30 17 LYS A 31 ? ? -164.40 115.47 31 18 LYS A 31 ? ? 70.08 -64.08 32 19 SER A 3 ? ? -109.36 40.66 33 20 SER A 2 ? ? 60.44 68.67 34 20 LYS A 31 ? ? -168.62 -50.08 35 20 LYS A 34 ? ? 72.55 -65.42 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 6 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 51 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.075 _pdbx_validate_planes.type 'SIDE CHAIN' #