data_2JTQ # _entry.id 2JTQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JTQ pdb_00002jtq 10.2210/pdb2jtq/pdb RCSB RCSB100278 ? ? WWPDB D_1000100278 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2JTR . unspecified PDB 2JTS . unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JTQ _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-08-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jin, C.' 1 'Li, H.' 2 # _citation.id primary _citation.title ;Solution structures and backbone dynamics of Escherichia coli rhodanese PspE in its sulfur-free and persulfide-intermediate forms: implications for the catalytic mechanism of rhodanese. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 47 _citation.page_first 4377 _citation.page_last 4385 _citation.year 2008 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18355042 _citation.pdbx_database_id_DOI 10.1021/bi800039n # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, H.' 1 ? primary 'Yang, F.' 2 ? primary 'Kang, X.' 3 ? primary 'Xia, B.' 4 ? primary 'Jin, C.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Phage shock protein E' _entity.formula_weight 9441.697 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.8.1.1 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AEHWIDVRVPEQYQQEHVQGAINIPLKEVKERIATAVPDKNDTVKVYCNAGRQSGQAKEILSEMGYTHVENAGGLKDIAM PKVKG ; _entity_poly.pdbx_seq_one_letter_code_can ;AEHWIDVRVPEQYQQEHVQGAINIPLKEVKERIATAVPDKNDTVKVYCNAGRQSGQAKEILSEMGYTHVENAGGLKDIAM PKVKG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 HIS n 1 4 TRP n 1 5 ILE n 1 6 ASP n 1 7 VAL n 1 8 ARG n 1 9 VAL n 1 10 PRO n 1 11 GLU n 1 12 GLN n 1 13 TYR n 1 14 GLN n 1 15 GLN n 1 16 GLU n 1 17 HIS n 1 18 VAL n 1 19 GLN n 1 20 GLY n 1 21 ALA n 1 22 ILE n 1 23 ASN n 1 24 ILE n 1 25 PRO n 1 26 LEU n 1 27 LYS n 1 28 GLU n 1 29 VAL n 1 30 LYS n 1 31 GLU n 1 32 ARG n 1 33 ILE n 1 34 ALA n 1 35 THR n 1 36 ALA n 1 37 VAL n 1 38 PRO n 1 39 ASP n 1 40 LYS n 1 41 ASN n 1 42 ASP n 1 43 THR n 1 44 VAL n 1 45 LYS n 1 46 VAL n 1 47 TYR n 1 48 CYS n 1 49 ASN n 1 50 ALA n 1 51 GLY n 1 52 ARG n 1 53 GLN n 1 54 SER n 1 55 GLY n 1 56 GLN n 1 57 ALA n 1 58 LYS n 1 59 GLU n 1 60 ILE n 1 61 LEU n 1 62 SER n 1 63 GLU n 1 64 MET n 1 65 GLY n 1 66 TYR n 1 67 THR n 1 68 HIS n 1 69 VAL n 1 70 GLU n 1 71 ASN n 1 72 ALA n 1 73 GLY n 1 74 GLY n 1 75 LEU n 1 76 LYS n 1 77 ASP n 1 78 ILE n 1 79 ALA n 1 80 MET n 1 81 PRO n 1 82 LYS n 1 83 VAL n 1 84 LYS n 1 85 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene pspE _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PSPE_ECOLI _struct_ref.pdbx_db_accession P23857 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AEHWIDVRVPEQYQQEHVQGAINIPLKEVKERIATAVPDKNDTVKVYCNAGRQSGQAKEILSEMGYTHVENAGGLKDIAM PKVKG ; _struct_ref.pdbx_align_begin 20 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JTQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 85 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P23857 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 104 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 85 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' 1 3 1 '2D 1H-15N HSQC' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D C(CO)NH' 1 6 1 '3D HNCO' 1 7 1 '3D HNCA' 1 8 1 '3D HNCACB' 1 9 1 '3D HBHA(CO)NH' 1 10 1 '3D HN(CO)CA' 1 11 1 '3D H(CCO)NH' 1 12 1 '3D HCCH-TOCSY' 1 13 1 '3D 1H-15N TOCSY' 1 14 1 '3D HCCH-COSY' 1 15 1 '3D HCACO' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.03 _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM [U-13C; U-15N] rhodanese, 20 mM TRIS, 40 mM DTT, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' 500 Bruker AVANCE 3 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2JTQ _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 21 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JTQ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JTQ _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, et.al.' refinement Amber 7 1 'Guntert, Mumenthaler and Wuthrich' 'initial structure calculation' CYANA 2.0 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 'Johnson, One Moon Scientific' processing NMRView ? 4 'Koradi, Billeter and Wuthrich' 'geometry optimization' MOLMOL ? 5 'Cornilescu, Delaglio and Bax' 'angle restraints' TALOS ? 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JTQ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JTQ _struct.title 'Rhodanese from E.coli' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2JTQ _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'solution structure rhodanese, Stress response, TRANSFERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 9 ? GLN A 14 ? VAL A 9 GLN A 14 1 ? 6 HELX_P HELX_P2 2 PRO A 25 ? VAL A 37 ? PRO A 25 VAL A 37 1 ? 13 HELX_P HELX_P3 3 GLY A 51 ? MET A 64 ? GLY A 51 MET A 64 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 22 ? ASN A 23 ? ILE A 22 ASN A 23 A 2 GLU A 2 ? ASP A 6 ? GLU A 2 ASP A 6 A 3 THR A 43 ? CYS A 48 ? THR A 43 CYS A 48 A 4 VAL A 69 ? GLY A 74 ? VAL A 69 GLY A 74 B 1 GLU A 16 ? VAL A 18 ? GLU A 16 VAL A 18 B 2 LYS A 82 ? LYS A 84 ? LYS A 82 LYS A 84 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 22 ? O ILE A 22 N ASP A 6 ? N ASP A 6 A 2 3 N HIS A 3 ? N HIS A 3 O LYS A 45 ? O LYS A 45 A 3 4 N VAL A 46 ? N VAL A 46 O ALA A 72 ? O ALA A 72 B 1 2 N HIS A 17 ? N HIS A 17 O VAL A 83 ? O VAL A 83 # _atom_sites.entry_id 2JTQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLY 85 85 85 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-06-17 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id rhodanese 1 mM '[U-13C; U-15N]' 1 TRIS 20 mM ? 1 DTT 40 mM ? 1 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH2 A ARG 32 ? ? 114.99 120.30 -5.31 0.50 N 2 1 NE A ARG 52 ? ? CZ A ARG 52 ? ? NH2 A ARG 52 ? ? 113.48 120.30 -6.82 0.50 N 3 3 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH2 A ARG 32 ? ? 117.27 120.30 -3.03 0.50 N 4 7 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH2 A ARG 8 ? ? 116.99 120.30 -3.31 0.50 N 5 7 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH2 A ARG 32 ? ? 117.17 120.30 -3.13 0.50 N 6 11 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH2 A ARG 32 ? ? 117.27 120.30 -3.03 0.50 N 7 17 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH2 A ARG 8 ? ? 116.30 120.30 -4.00 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 19 ? ? -58.03 108.30 2 1 CYS A 48 ? ? -147.83 -151.71 3 2 GLN A 14 ? ? -78.64 22.10 4 2 GLN A 15 ? ? -135.64 -38.16 5 2 GLN A 19 ? ? -77.34 43.74 6 2 GLU A 31 ? ? -121.50 -50.10 7 3 CYS A 48 ? ? -153.13 -157.78 8 3 ALA A 50 ? ? -140.47 19.56 9 4 GLN A 19 ? ? -74.47 48.05 10 4 GLU A 31 ? ? -127.45 -51.05 11 4 LYS A 40 ? ? 58.38 -28.00 12 4 HIS A 68 ? ? -141.07 25.74 13 5 CYS A 48 ? ? -148.26 -156.78 14 6 GLU A 31 ? ? -124.88 -50.98 15 7 GLN A 14 ? ? -68.23 1.29 16 7 CYS A 48 ? ? -150.88 -157.73 17 7 HIS A 68 ? ? -141.24 36.96 18 8 GLU A 31 ? ? -123.17 -51.60 19 8 VAL A 37 ? ? -142.94 59.50 20 8 LYS A 40 ? ? 57.82 -17.25 21 8 CYS A 48 ? ? -150.65 -145.18 22 8 ALA A 50 ? ? -143.53 -23.95 23 9 GLN A 15 ? ? -130.23 -41.34 24 9 CYS A 48 ? ? -152.43 -156.44 25 10 GLN A 14 ? ? -69.66 0.63 26 10 GLN A 19 ? ? -76.04 48.23 27 10 LYS A 40 ? ? 59.53 -15.37 28 10 CYS A 48 ? ? -147.77 -147.10 29 10 ALA A 50 ? ? -147.17 -35.63 30 11 CYS A 48 ? ? -148.84 -141.91 31 11 ALA A 50 ? ? -149.88 -9.18 32 12 GLU A 31 ? ? -124.95 -50.14 33 12 CYS A 48 ? ? -162.64 -162.48 34 12 ALA A 50 ? ? 49.68 24.17 35 13 GLU A 16 ? ? -171.41 146.51 36 13 VAL A 37 ? ? -141.02 52.05 37 13 CYS A 48 ? ? -150.47 -155.75 38 14 ALA A 21 ? ? 59.88 -175.37 39 14 GLU A 31 ? ? -131.21 -48.46 40 14 CYS A 48 ? ? -162.94 -159.42 41 15 CYS A 48 ? ? -143.74 -154.21 42 15 ALA A 50 ? ? -145.78 -39.05 43 16 CYS A 48 ? ? -148.80 -151.25 44 16 ALA A 50 ? ? -146.43 -9.64 45 17 CYS A 48 ? ? -134.53 -144.38 46 17 ALA A 50 ? ? -144.46 -26.21 47 18 VAL A 37 ? ? -142.59 40.82 48 18 LYS A 40 ? ? 62.52 -11.33 49 18 CYS A 48 ? ? -147.13 -141.95 50 18 ALA A 50 ? ? -143.76 -41.15 51 20 GLN A 15 ? ? -131.81 -36.64 52 20 THR A 43 ? ? -68.25 98.44 53 20 CYS A 48 ? ? -148.61 -145.67 54 20 ALA A 50 ? ? -144.28 -35.63 55 21 VAL A 44 ? ? -69.86 97.84 56 21 CYS A 48 ? ? -149.50 -155.70 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 TYR A 66 ? ? 0.075 'SIDE CHAIN' 2 4 ARG A 8 ? ? 0.099 'SIDE CHAIN' 3 4 TYR A 66 ? ? 0.082 'SIDE CHAIN' 4 5 TYR A 66 ? ? 0.083 'SIDE CHAIN' 5 8 TYR A 66 ? ? 0.087 'SIDE CHAIN' 6 10 TYR A 66 ? ? 0.092 'SIDE CHAIN' 7 14 ARG A 8 ? ? 0.098 'SIDE CHAIN' 8 14 TYR A 66 ? ? 0.075 'SIDE CHAIN' 9 15 TYR A 66 ? ? 0.092 'SIDE CHAIN' 10 17 TYR A 66 ? ? 0.076 'SIDE CHAIN' 11 18 ARG A 8 ? ? 0.126 'SIDE CHAIN' 12 19 TYR A 66 ? ? 0.082 'SIDE CHAIN' #