data_2JVK # _entry.id 2JVK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JVK pdb_00002jvk 10.2210/pdb2jvk/pdb RCSB RCSB100344 ? ? WWPDB D_1000100344 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.content_type 15010 BMRB 'Chemical Shift Assignments' unspecified 1fsp PDB 'Wild-type Spo0F' unspecified 2jvi PDB . unspecified 2jvj PDB . unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JVK _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-09-20 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bobay, B.G.' 1 'McLaughlin, P.D.' 2 'Thompson, R.J.' 3 'Hoch, J.A.' 4 'Cavanagh, J.' 5 # _citation.id primary _citation.title 'Covariance identifies dynamic residues at the interfaces in protein/protein complexes' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bobay, B.G.' 1 ? primary 'White, R.A.' 2 ? primary 'Szurmant, H.' 3 ? primary 'Sullivan, D.M.' 4 ? primary 'McLaughlin, P.D.' 5 ? primary 'Hwa, T.' 6 ? primary 'Hoch, J.A.' 7 ? primary 'Cavanagh, J.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Sporulation initiation phosphotransferase F' _entity.formula_weight 15273.733 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.-.- _entity.pdbx_mutation L66A _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Stage 0 sporulation protein F' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEIAKRMKVIDENIRVII MTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSNLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEIAKRMKVIDENIRVII MTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSNLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 MET n 1 3 ASN n 1 4 GLU n 1 5 LYS n 1 6 ILE n 1 7 LEU n 1 8 ILE n 1 9 VAL n 1 10 ASP n 1 11 ASP n 1 12 GLN n 1 13 TYR n 1 14 GLY n 1 15 ILE n 1 16 ARG n 1 17 ILE n 1 18 LEU n 1 19 LEU n 1 20 ASN n 1 21 GLU n 1 22 VAL n 1 23 PHE n 1 24 ASN n 1 25 LYS n 1 26 GLU n 1 27 GLY n 1 28 TYR n 1 29 GLN n 1 30 THR n 1 31 PHE n 1 32 GLN n 1 33 ALA n 1 34 ALA n 1 35 ASN n 1 36 GLY n 1 37 LEU n 1 38 GLN n 1 39 ALA n 1 40 LEU n 1 41 ASP n 1 42 ILE n 1 43 VAL n 1 44 THR n 1 45 LYS n 1 46 GLU n 1 47 ARG n 1 48 PRO n 1 49 ASP n 1 50 LEU n 1 51 VAL n 1 52 LEU n 1 53 LEU n 1 54 ASP n 1 55 MET n 1 56 LYS n 1 57 ILE n 1 58 PRO n 1 59 GLY n 1 60 MET n 1 61 ASP n 1 62 GLY n 1 63 ILE n 1 64 GLU n 1 65 ILE n 1 66 ALA n 1 67 LYS n 1 68 ARG n 1 69 MET n 1 70 LYS n 1 71 VAL n 1 72 ILE n 1 73 ASP n 1 74 GLU n 1 75 ASN n 1 76 ILE n 1 77 ARG n 1 78 VAL n 1 79 ILE n 1 80 ILE n 1 81 MET n 1 82 THR n 1 83 ALA n 1 84 TYR n 1 85 GLY n 1 86 GLU n 1 87 LEU n 1 88 ASP n 1 89 MET n 1 90 ILE n 1 91 GLN n 1 92 GLU n 1 93 SER n 1 94 LYS n 1 95 GLU n 1 96 LEU n 1 97 GLY n 1 98 ALA n 1 99 LEU n 1 100 THR n 1 101 HIS n 1 102 PHE n 1 103 ALA n 1 104 LYS n 1 105 PRO n 1 106 PHE n 1 107 ASP n 1 108 ILE n 1 109 ASP n 1 110 GLU n 1 111 ILE n 1 112 ARG n 1 113 ASP n 1 114 ALA n 1 115 VAL n 1 116 LYS n 1 117 LYS n 1 118 TYR n 1 119 LEU n 1 120 PRO n 1 121 LEU n 1 122 LYS n 1 123 SER n 1 124 ASN n 1 125 LEU n 1 126 GLU n 1 127 HIS n 1 128 HIS n 1 129 HIS n 1 130 HIS n 1 131 HIS n 1 132 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene spo0F _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE)3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-20b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SP0F_BACSU _struct_ref.pdbx_db_accession P06628 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVII MTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JVK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06628 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 124 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 124 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JVK ALA A 66 ? UNP P06628 LEU 66 'engineered mutation' 66 1 1 2JVK LEU A 125 ? UNP P06628 ? ? 'expression tag' 125 2 1 2JVK GLU A 126 ? UNP P06628 ? ? 'expression tag' 126 3 1 2JVK HIS A 127 ? UNP P06628 ? ? 'expression tag' 127 4 1 2JVK HIS A 128 ? UNP P06628 ? ? 'expression tag' 128 5 1 2JVK HIS A 129 ? UNP P06628 ? ? 'expression tag' 129 6 1 2JVK HIS A 130 ? UNP P06628 ? ? 'expression tag' 130 7 1 2JVK HIS A 131 ? UNP P06628 ? ? 'expression tag' 131 8 1 2JVK HIS A 132 ? UNP P06628 ? ? 'expression tag' 132 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D HNCO' 1 6 1 '3D HN(CA)CO' 1 7 1 '3D HNCA' 1 8 1 '3D HN(CO)CA' 1 9 1 '3D C(CO)NH' 1 10 1 '3D 1H-15N TOCSY' 1 11 2 '3D HCCH-TOCSY' 1 12 1 '3D 1H-15N NOESY' 1 13 2 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 25 _pdbx_nmr_exptl_sample_conditions.pH 6.9 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '25 mM TRIS, 50 mM potassium chloride, 0.02 % sodium azide, 1 mM [U-100% 13C; U-100% 15N] protein, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '25 mM TRIS, 50 mM potassium chloride, 0.02 % sodium azide, 1 mM [U-100% 13C; U-100% 15N] protein, 100% D2O' 2 '100% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2JVK _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JVK _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 1.8 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 6.0 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JVK _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Johnson, One Moon Scientific' 'data analysis' NMRView 5.0 2 ;Linge, O'Donoghue and Nilges ; refinement ARIA 1.2 3 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 1.2 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JVK _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JVK _struct.title 'NMR Solution Structure of the Hyper-Sporulation Response Regulator Spo0F Mutant L66A from Bacillus subtilis' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JVK _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;RESPONSE REGULATOR, TWO-COMPONENT SYSTEMS, BACTERIAL SIGNAL TRANSDUCTION, PHOSPHO-RELAY, (BETA/ALPHA)5 PROTEIN, Cytoplasm, Kinase, Magnesium, Metal-binding, Phosphorylation, Sporulation, Transferase, Two-component regulatory system ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 13 ? GLY A 27 ? TYR A 13 GLY A 27 1 ? 15 HELX_P HELX_P2 2 GLY A 36 ? ARG A 47 ? GLY A 36 ARG A 47 1 ? 12 HELX_P HELX_P3 3 GLY A 62 ? ASP A 73 ? GLY A 62 ASP A 73 1 ? 12 HELX_P HELX_P4 4 MET A 89 ? LEU A 96 ? MET A 89 LEU A 96 1 ? 8 HELX_P HELX_P5 5 ASP A 107 ? LEU A 119 ? ASP A 107 LEU A 119 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 29 ? ALA A 33 ? GLN A 29 ALA A 33 A 2 LYS A 5 ? VAL A 9 ? LYS A 5 VAL A 9 A 3 LEU A 50 ? ASP A 54 ? LEU A 50 ASP A 54 A 4 VAL A 78 ? THR A 82 ? VAL A 78 THR A 82 A 5 ALA A 98 ? ALA A 103 ? ALA A 98 ALA A 103 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 33 ? O ALA A 33 N ILE A 8 ? N ILE A 8 A 2 3 N LEU A 7 ? N LEU A 7 O LEU A 52 ? O LEU A 52 A 3 4 N LEU A 53 ? N LEU A 53 O ILE A 79 ? O ILE A 79 A 4 5 N ILE A 80 ? N ILE A 80 O PHE A 102 ? O PHE A 102 # _atom_sites.entry_id 2JVK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 HIS 132 132 132 HIS HIS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-02-05 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.036 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.002 _pdbx_nmr_ensemble_rms.entry_id 2JVK _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id TRIS 25 mM ? 1 'potassium chloride' 50 mM ? 1 'sodium azide' 0.02 % ? 1 entity 1 mM '[U-100% 13C; U-100% 15N]' 1 TRIS 25 mM ? 2 'potassium chloride' 50 mM ? 2 'sodium azide' 0.02 % ? 2 entity 1 mM '[U-100% 13C; U-100% 15N]' 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2JVK _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 3582 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 654 _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count 1105 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 2928 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD23 A LEU 121 ? ? H A LYS 122 ? ? 1.26 2 1 HZ2 A LYS 5 ? ? OE1 A GLU 46 ? ? 1.60 3 2 HG A LEU 121 ? ? HE3 A LYS 122 ? ? 1.05 4 2 HA A ARG 77 ? ? HG A LEU 99 ? ? 1.30 5 2 HG21 A ILE 63 ? ? HG2 A MET 89 ? ? 1.33 6 2 OD2 A ASP 54 ? ? HZ3 A LYS 104 ? ? 1.54 7 2 OD1 A ASP 113 ? ? HZ1 A LYS 116 ? ? 1.56 8 3 HD3 A LYS 67 ? ? HD21 A LEU 96 ? ? 1.19 9 3 HA A ARG 77 ? ? HG A LEU 99 ? ? 1.29 10 3 HD22 A ASN 35 ? ? HB2 A MET 60 ? ? 1.30 11 3 OD1 A ASP 113 ? ? HZ1 A LYS 116 ? ? 1.53 12 4 HB3 A ASP 107 ? ? HB3 A GLU 110 ? ? 1.26 13 4 OD2 A ASP 54 ? ? HZ1 A LYS 104 ? ? 1.54 14 5 HA A ASP 113 ? ? HE2 A LYS 116 ? ? 1.32 15 6 HB3 A ASP 11 ? ? HG2 A PRO 58 ? ? 1.12 16 6 HG22 A VAL 51 ? ? HA A VAL 78 ? ? 1.33 17 6 HB2 A LEU 7 ? ? HG13 A VAL 51 ? ? 1.34 18 6 OD1 A ASP 113 ? ? HZ1 A LYS 116 ? ? 1.56 19 7 HZ3 A LYS 5 ? ? OE1 A GLU 46 ? ? 1.56 20 7 HZ1 A LYS 56 ? ? OE2 A GLU 86 ? ? 1.59 21 8 HB3 A ASP 11 ? ? HG2 A PRO 58 ? ? 1.15 22 8 HG21 A VAL 51 ? ? HA A VAL 78 ? ? 1.30 23 9 HA A TYR 13 ? ? HE A ARG 16 ? ? 1.14 24 9 HD1 A PHE 102 ? ? H A ALA 103 ? ? 1.24 25 9 HB2 A ASP 11 ? ? HG2 A PRO 58 ? ? 1.26 26 9 HZ1 A LYS 56 ? ? OE2 A GLU 86 ? ? 1.60 27 10 HA A ASP 109 ? ? HE A ARG 112 ? ? 1.27 28 10 HB3 A ASP 11 ? ? HG2 A PRO 58 ? ? 1.29 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 3 ? ? 61.41 65.85 2 1 TYR A 13 ? ? 81.71 -29.25 3 1 ASN A 35 ? ? -167.44 -44.15 4 1 ARG A 47 ? ? 51.92 77.37 5 1 PRO A 48 ? ? -56.99 -175.93 6 1 PRO A 58 ? ? -52.42 88.86 7 1 MET A 60 ? ? 67.62 -177.35 8 1 ASP A 73 ? ? -145.98 -16.29 9 1 GLU A 74 ? ? 77.77 -25.38 10 1 ASN A 75 ? ? -175.05 74.13 11 1 ILE A 76 ? ? -82.43 32.98 12 1 ALA A 83 ? ? -74.15 40.34 13 1 TYR A 84 ? ? 64.37 -37.45 14 1 GLU A 86 ? ? -88.09 -74.66 15 1 LEU A 96 ? ? -102.39 60.84 16 1 THR A 100 ? ? -174.73 -169.29 17 1 PRO A 105 ? ? -67.74 17.67 18 1 TYR A 118 ? ? -105.67 -64.34 19 1 LEU A 121 ? ? -164.39 -39.87 20 1 LYS A 122 ? ? -155.30 -34.99 21 1 HIS A 127 ? ? -143.56 19.18 22 1 HIS A 130 ? ? 63.83 63.84 23 1 HIS A 131 ? ? -153.90 -42.19 24 2 MET A 2 ? ? -90.35 -72.02 25 2 ASN A 3 ? ? -167.71 77.16 26 2 TYR A 13 ? ? 76.62 -41.81 27 2 ASN A 35 ? ? -165.66 -43.97 28 2 ARG A 47 ? ? 53.58 70.88 29 2 ASP A 73 ? ? -155.81 -15.06 30 2 GLU A 74 ? ? 77.31 -69.84 31 2 ILE A 76 ? ? -72.73 29.23 32 2 ALA A 83 ? ? -75.65 33.64 33 2 TYR A 84 ? ? 66.16 -34.51 34 2 GLU A 86 ? ? -85.82 -75.26 35 2 THR A 100 ? ? -175.15 -162.60 36 2 PHE A 102 ? ? -138.71 -156.55 37 2 PRO A 105 ? ? -58.58 1.26 38 2 PHE A 106 ? ? -46.38 156.92 39 2 TYR A 118 ? ? -103.34 -72.42 40 2 LEU A 121 ? ? -169.35 -19.93 41 2 LYS A 122 ? ? -176.28 -79.54 42 2 SER A 123 ? ? 61.60 -173.04 43 2 HIS A 128 ? ? -119.39 -100.74 44 2 HIS A 129 ? ? 178.24 135.89 45 2 HIS A 130 ? ? -69.11 92.99 46 3 ASN A 3 ? ? 63.57 74.32 47 3 TYR A 13 ? ? 75.98 -33.49 48 3 ARG A 47 ? ? 55.67 80.23 49 3 ASP A 73 ? ? -141.90 -0.14 50 3 GLU A 74 ? ? 67.31 -70.53 51 3 ASN A 75 ? ? -117.24 58.83 52 3 ILE A 76 ? ? -67.64 15.51 53 3 ARG A 77 ? ? 70.12 44.88 54 3 TYR A 84 ? ? 71.07 -32.51 55 3 GLU A 86 ? ? -78.49 -77.56 56 3 ASP A 88 ? ? -63.95 -84.01 57 3 THR A 100 ? ? -174.08 -165.18 58 3 PHE A 106 ? ? -66.62 -176.21 59 3 TYR A 118 ? ? -106.09 -67.57 60 3 LYS A 122 ? ? -152.17 -52.80 61 3 HIS A 127 ? ? -57.22 105.95 62 3 HIS A 131 ? ? -174.03 -18.32 63 4 TYR A 13 ? ? 75.66 -43.78 64 4 ASN A 35 ? ? -164.97 -43.35 65 4 ARG A 47 ? ? 54.31 81.95 66 4 PRO A 58 ? ? -64.91 33.31 67 4 GLU A 74 ? ? 74.90 -24.14 68 4 ASN A 75 ? ? -175.91 74.78 69 4 TYR A 84 ? ? -34.17 100.99 70 4 GLU A 86 ? ? -63.22 -76.62 71 4 THR A 100 ? ? -176.10 -159.96 72 4 PHE A 106 ? ? 41.51 -166.12 73 4 LEU A 121 ? ? -138.96 -38.39 74 4 LYS A 122 ? ? -151.18 -75.44 75 4 SER A 123 ? ? 51.22 -173.43 76 4 LEU A 125 ? ? -151.32 -53.45 77 5 MET A 2 ? ? 65.94 175.20 78 5 TYR A 13 ? ? 80.32 -35.27 79 5 ARG A 47 ? ? 58.16 84.33 80 5 GLU A 74 ? ? 72.51 -72.24 81 5 ASN A 75 ? ? -117.05 55.56 82 5 ILE A 76 ? ? -70.84 27.92 83 5 ALA A 83 ? ? -77.71 42.25 84 5 TYR A 84 ? ? 40.82 82.79 85 5 GLU A 86 ? ? -69.58 -78.27 86 5 THR A 100 ? ? -170.22 -169.20 87 5 PHE A 102 ? ? -138.40 -156.31 88 5 PRO A 105 ? ? -66.92 17.91 89 5 PHE A 106 ? ? -48.33 160.40 90 5 TYR A 118 ? ? -98.29 -69.68 91 5 LEU A 121 ? ? -140.58 -24.03 92 5 LYS A 122 ? ? -156.32 -94.03 93 5 SER A 123 ? ? 53.64 167.89 94 5 LEU A 125 ? ? -99.10 -63.80 95 5 GLU A 126 ? ? 60.31 -82.21 96 5 HIS A 128 ? ? -94.87 47.82 97 5 HIS A 129 ? ? 75.62 162.14 98 5 HIS A 130 ? ? 68.51 94.80 99 6 ASN A 3 ? ? 178.41 64.54 100 6 TYR A 13 ? ? 77.62 -35.99 101 6 ASN A 35 ? ? -165.43 -47.79 102 6 ARG A 47 ? ? 50.49 71.59 103 6 PRO A 58 ? ? -33.67 101.79 104 6 ASP A 73 ? ? -146.32 -16.01 105 6 GLU A 74 ? ? 73.76 -22.95 106 6 ASN A 75 ? ? -170.93 73.51 107 6 ALA A 83 ? ? -74.06 46.58 108 6 TYR A 84 ? ? 52.21 -24.97 109 6 GLU A 86 ? ? -71.15 -74.10 110 6 MET A 89 ? ? 58.80 19.90 111 6 LEU A 96 ? ? -103.48 54.24 112 6 THR A 100 ? ? -175.66 -169.98 113 6 PHE A 102 ? ? -136.21 -156.60 114 6 PHE A 106 ? ? 48.12 173.68 115 6 TYR A 118 ? ? -91.41 -64.72 116 6 LEU A 121 ? ? -161.66 -53.29 117 6 SER A 123 ? ? -66.30 -176.58 118 6 HIS A 131 ? ? -178.73 94.81 119 7 TYR A 13 ? ? 81.23 -40.31 120 7 ASN A 35 ? ? -161.01 -44.09 121 7 ARG A 47 ? ? 57.92 78.30 122 7 PRO A 48 ? ? -60.29 -171.59 123 7 PRO A 58 ? ? -47.47 109.62 124 7 GLU A 74 ? ? 71.21 -20.22 125 7 ASN A 75 ? ? -175.89 74.95 126 7 ILE A 76 ? ? -81.59 32.36 127 7 ALA A 83 ? ? -76.67 37.24 128 7 TYR A 84 ? ? 56.56 16.31 129 7 GLU A 86 ? ? -80.99 -74.74 130 7 ASP A 88 ? ? -80.87 -74.30 131 7 LEU A 96 ? ? -100.02 63.31 132 7 TYR A 118 ? ? -97.00 -68.22 133 7 LEU A 121 ? ? -164.88 -32.19 134 7 LYS A 122 ? ? -172.46 -36.52 135 7 LEU A 125 ? ? -167.88 78.84 136 7 HIS A 128 ? ? -143.60 -72.54 137 7 HIS A 131 ? ? -146.07 -30.19 138 8 ASN A 3 ? ? -179.21 70.80 139 8 TYR A 13 ? ? 87.98 -28.97 140 8 ARG A 47 ? ? 51.52 71.39 141 8 MET A 60 ? ? 65.38 -161.78 142 8 ASP A 73 ? ? -145.72 -7.97 143 8 GLU A 74 ? ? 66.94 -75.95 144 8 ASN A 75 ? ? -113.31 56.86 145 8 ILE A 76 ? ? -67.84 19.07 146 8 ALA A 83 ? ? -78.13 25.44 147 8 TYR A 84 ? ? 68.27 -24.60 148 8 GLU A 86 ? ? -70.65 -72.82 149 8 ASP A 88 ? ? -75.75 -70.55 150 8 LEU A 96 ? ? -97.21 49.14 151 8 THR A 100 ? ? -175.10 -167.60 152 8 PHE A 102 ? ? -119.85 -162.31 153 8 TYR A 118 ? ? -100.46 -67.41 154 8 LEU A 121 ? ? -158.83 -29.84 155 8 LYS A 122 ? ? -159.08 -47.58 156 8 HIS A 129 ? ? -169.41 -88.35 157 8 HIS A 130 ? ? 57.20 84.82 158 9 TYR A 13 ? ? 73.24 -54.71 159 9 ASN A 35 ? ? -177.96 -45.51 160 9 ARG A 47 ? ? 52.41 83.42 161 9 PRO A 48 ? ? -75.39 -164.06 162 9 MET A 60 ? ? 64.81 -172.51 163 9 GLU A 74 ? ? 75.01 -50.40 164 9 ARG A 77 ? ? 71.63 50.50 165 9 ALA A 83 ? ? -74.38 42.70 166 9 TYR A 84 ? ? 63.64 -40.42 167 9 GLU A 86 ? ? -74.35 -78.23 168 9 LEU A 87 ? ? 43.64 70.34 169 9 ASP A 88 ? ? -87.40 -73.98 170 9 THR A 100 ? ? 178.27 -165.96 171 9 PHE A 102 ? ? -120.33 -160.67 172 9 PRO A 105 ? ? -64.57 15.19 173 9 TYR A 118 ? ? -107.23 -65.00 174 9 LYS A 122 ? ? -173.44 -65.95 175 9 ASN A 124 ? ? 66.67 -71.28 176 9 LEU A 125 ? ? 55.66 77.24 177 9 GLU A 126 ? ? 68.97 -177.21 178 9 HIS A 129 ? ? -133.58 -154.64 179 9 HIS A 131 ? ? 68.25 -90.21 180 10 MET A 2 ? ? 48.64 27.93 181 10 TYR A 13 ? ? 80.66 -33.79 182 10 ARG A 47 ? ? 54.57 72.75 183 10 PRO A 48 ? ? -64.05 -173.39 184 10 PRO A 58 ? ? -37.24 -35.02 185 10 MET A 60 ? ? 46.62 127.44 186 10 ASP A 73 ? ? -140.32 -11.20 187 10 GLU A 74 ? ? 73.57 -26.42 188 10 ASN A 75 ? ? -174.52 75.92 189 10 ALA A 83 ? ? -76.87 39.41 190 10 TYR A 84 ? ? 63.56 -28.31 191 10 GLU A 86 ? ? -74.53 -76.42 192 10 ASP A 88 ? ? -80.20 -75.86 193 10 LEU A 96 ? ? -114.45 52.48 194 10 PHE A 102 ? ? -137.45 -155.25 195 10 PHE A 106 ? ? 45.85 -178.42 196 10 TYR A 118 ? ? -90.81 -62.78 197 10 LEU A 121 ? ? -155.87 -37.61 198 10 ASN A 124 ? ? -101.97 60.06 199 10 HIS A 128 ? ? 62.89 -70.85 200 10 HIS A 131 ? ? 63.72 -167.16 #