data_2JYN # _entry.id 2JYN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JYN pdb_00002jyn 10.2210/pdb2jyn/pdb RCSB RCSB100454 ? ? WWPDB D_1000100454 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id YT51 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JYN _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-12-14 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, B.' 1 'Yee, A.' 2 'Fares, C.' 3 'Lemak, A.' 4 'Gutmanas, A.' 5 'Semest, A.' 6 'Arrowsmith, C.H.' 7 'Northeast Structural Genomics Consortium (NESG)' 8 'Ontario Centre for Structural Proteomics (OCSP)' 9 # _citation.id primary _citation.title 'A novel solution NMR structure of protein yst0336 from Saccharomyces cerevisiae.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, B.' 1 ? primary 'Yee, A.' 2 ? primary 'Fares, C.' 3 ? primary 'Lemak, A.' 4 ? primary 'Gutmanas, A.' 5 ? primary 'Semest, A.' 6 ? primary 'Arrowsmith, C.H.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'UPF0368 protein YPL225W' _entity.formula_weight 17468.711 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSTFNAETADNLEDIEKQFAVVAVEQAETYWKLLTSVPGSKLRLTKFDDEIYENFMERFPEYKDVERVKKFTEEELKTKE AKERWRKFFTIFEKKIEDYNFGTLLRTDASAEYGQFTTCFVVRLQFYAFEIARNKHGLNDWIVGQK ; _entity_poly.pdbx_seq_one_letter_code_can ;MSTFNAETADNLEDIEKQFAVVAVEQAETYWKLLTSVPGSKLRLTKFDDEIYENFMERFPEYKDVERVKKFTEEELKTKE AKERWRKFFTIFEKKIEDYNFGTLLRTDASAEYGQFTTCFVVRLQFYAFEIARNKHGLNDWIVGQK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier YT51 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 THR n 1 4 PHE n 1 5 ASN n 1 6 ALA n 1 7 GLU n 1 8 THR n 1 9 ALA n 1 10 ASP n 1 11 ASN n 1 12 LEU n 1 13 GLU n 1 14 ASP n 1 15 ILE n 1 16 GLU n 1 17 LYS n 1 18 GLN n 1 19 PHE n 1 20 ALA n 1 21 VAL n 1 22 VAL n 1 23 ALA n 1 24 VAL n 1 25 GLU n 1 26 GLN n 1 27 ALA n 1 28 GLU n 1 29 THR n 1 30 TYR n 1 31 TRP n 1 32 LYS n 1 33 LEU n 1 34 LEU n 1 35 THR n 1 36 SER n 1 37 VAL n 1 38 PRO n 1 39 GLY n 1 40 SER n 1 41 LYS n 1 42 LEU n 1 43 ARG n 1 44 LEU n 1 45 THR n 1 46 LYS n 1 47 PHE n 1 48 ASP n 1 49 ASP n 1 50 GLU n 1 51 ILE n 1 52 TYR n 1 53 GLU n 1 54 ASN n 1 55 PHE n 1 56 MET n 1 57 GLU n 1 58 ARG n 1 59 PHE n 1 60 PRO n 1 61 GLU n 1 62 TYR n 1 63 LYS n 1 64 ASP n 1 65 VAL n 1 66 GLU n 1 67 ARG n 1 68 VAL n 1 69 LYS n 1 70 LYS n 1 71 PHE n 1 72 THR n 1 73 GLU n 1 74 GLU n 1 75 GLU n 1 76 LEU n 1 77 LYS n 1 78 THR n 1 79 LYS n 1 80 GLU n 1 81 ALA n 1 82 LYS n 1 83 GLU n 1 84 ARG n 1 85 TRP n 1 86 ARG n 1 87 LYS n 1 88 PHE n 1 89 PHE n 1 90 THR n 1 91 ILE n 1 92 PHE n 1 93 GLU n 1 94 LYS n 1 95 LYS n 1 96 ILE n 1 97 GLU n 1 98 ASP n 1 99 TYR n 1 100 ASN n 1 101 PHE n 1 102 GLY n 1 103 THR n 1 104 LEU n 1 105 LEU n 1 106 ARG n 1 107 THR n 1 108 ASP n 1 109 ALA n 1 110 SER n 1 111 ALA n 1 112 GLU n 1 113 TYR n 1 114 GLY n 1 115 GLN n 1 116 PHE n 1 117 THR n 1 118 THR n 1 119 CYS n 1 120 PHE n 1 121 VAL n 1 122 VAL n 1 123 ARG n 1 124 LEU n 1 125 GLN n 1 126 PHE n 1 127 TYR n 1 128 ALA n 1 129 PHE n 1 130 GLU n 1 131 ILE n 1 132 ALA n 1 133 ARG n 1 134 ASN n 1 135 LYS n 1 136 HIS n 1 137 GLY n 1 138 LEU n 1 139 ASN n 1 140 ASP n 1 141 TRP n 1 142 ILE n 1 143 VAL n 1 144 GLY n 1 145 GLN n 1 146 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene YPL225W _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain S288c _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YP225_YEAST _struct_ref.pdbx_db_accession Q08971 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSTFNAETADNLEDIEKQFAVVAVEQAETYWKLLTSVPGSKLRLTKFDDEIYENFMERFPEYKDVERVKKFTEEELKTKE AKERWRKFFTIFEKKIEDYNFGTLLRTDASAEYGQFTTCFVVRLQFYAFEIARNKHGLNDWIVGQK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JYN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 146 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q08971 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 146 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 146 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCO' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCACB' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D HNCA' 1 6 1 '3D C(CO)NH' 1 7 1 '3D H(CCO)NH' 1 8 1 '3D HCCH-TOCSY' 1 9 1 '3D CCH-TOCSY' 1 10 1 '3D HBHA(CO)NH' 1 11 1 '3D 1H-15N NOESY' 1 12 1 '3D 1H-13C NOESY' 1 13 2 '3D 1H-13C NOESY' 1 14 1 '3D 1H-13C NOESY aromatic' 1 15 3 '2D 1H-13C HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 300 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.5 mM [U-100% 13C; U-100% 15N] protein yst0336, 10 mM [U-100% 2H] TRIS, 300 mM sodium chloride, 0.01 % sodium azide, 10 mM benzamidine, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.5 mM [U-100% 13C; U-100% 15N] protein yst0336, 10 mM [U-100% 2H] TRIS, 300 mM sodium chloride, 0.01 % sodium azide, 10 mM benzamidine, 99.9% D2O ; 2 '99.9% D2O' ;0.5 mM [U-100% 13C; U-100% 15N] protein yst0336, 10 mM [U-100% 2H] TRIS, 300 mM sodium chloride, 0.01 % sodium azide, 10 mM benzamidine, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2JYN _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JYN _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JYN _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2.3 1 Goddard 'data analysis' Sparky 3.95 2 Goddard 'peak picking' Sparky 3.95 3 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign ? 4 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.0 6 'Huang, Tejero, Powers and Montelione' 'nmr structure quality assessment' AutoStructure ? 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JYN _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JYN _struct.title ;A novel solution NMR structure of protein yst0336 from Saccharomyces cerevisiae. Northeast Structural Genomics Consortium target YT51/Ontario Centre for Structural Proteomics target yst0336 ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JYN _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;novel fold, yst0336, YT51, Ontario Centre for Structural Proteomics, OCSP, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Cytoplasm, STRUCTURAL GENOMICS, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 11 ? VAL A 37 ? ASN A 11 VAL A 37 1 ? 27 HELX_P HELX_P2 2 PHE A 47 ? PHE A 59 ? PHE A 47 PHE A 59 1 ? 13 HELX_P HELX_P3 3 ASP A 64 ? LYS A 70 ? ASP A 64 LYS A 70 1 ? 7 HELX_P HELX_P4 4 THR A 78 ? GLU A 93 ? THR A 78 GLU A 93 1 ? 16 HELX_P HELX_P5 5 VAL A 122 ? HIS A 136 ? VAL A 122 HIS A 136 1 ? 15 HELX_P HELX_P6 6 ASN A 139 ? VAL A 143 ? ASN A 139 VAL A 143 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 103 ? ARG A 106 ? THR A 103 ARG A 106 A 2 THR A 118 ? VAL A 121 ? THR A 118 VAL A 121 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 105 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 105 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id CYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 119 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 119 # _atom_sites.entry_id 2JYN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 TRP 85 85 85 TRP TRP A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 CYS 119 119 119 CYS CYS A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 HIS 136 136 136 HIS HIS A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 TRP 141 141 141 TRP TRP A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 GLN 145 145 145 GLN GLN A . n A 1 146 LYS 146 146 146 LYS LYS A . n # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'Northeast Structural Genomics Consortium' 1 NESG 'PSI, Protein Structure Initiative' 'Ontario Centre for Structural Proteomics' 2 OCSP ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-12-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'protein yst0336' 0.5 mM '[U-100% 13C; U-100% 15N]' 1 TRIS 10 mM '[U-100% 2H]' 1 'sodium chloride' 300 mM ? 1 'sodium azide' 0.01 % ? 1 benzamidine 10 mM ? 1 'protein yst0336' 0.5 mM '[U-100% 13C; U-100% 15N]' 2 TRIS 10 mM '[U-100% 2H]' 2 'sodium chloride' 300 mM ? 2 'sodium azide' 0.01 % ? 2 benzamidine 10 mM ? 2 'protein yst0336' 0.5 mM '[U-100% 13C; U-100% 15N]' 3 TRIS 10 mM '[U-100% 2H]' 3 'sodium chloride' 300 mM ? 3 'sodium azide' 0.01 % ? 3 benzamidine 10 mM ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 6 ? ? 66.96 177.22 2 1 LYS A 95 ? ? -142.67 -46.38 3 1 ASN A 100 ? ? -111.99 66.05 4 2 ALA A 9 ? ? -66.01 95.13 5 2 LYS A 95 ? ? -134.77 -59.62 6 2 PHE A 101 ? ? -127.75 -51.48 7 2 SER A 110 ? ? -91.31 39.92 8 2 GLN A 145 ? ? -67.16 -74.56 9 3 ASN A 11 ? ? -173.21 147.30 10 3 ASP A 98 ? ? -83.61 36.55 11 4 ASP A 10 ? ? 64.37 -93.65 12 4 ASN A 11 ? ? 48.00 -154.28 13 4 PRO A 38 ? ? -81.65 36.23 14 4 ASP A 98 ? ? -86.21 36.71 15 5 ALA A 6 ? ? 67.22 109.12 16 5 ASP A 10 ? ? -101.83 -76.15 17 5 LYS A 95 ? ? -135.44 -66.51 18 5 ASP A 98 ? ? -77.82 20.77 19 5 GLU A 112 ? ? -81.56 -158.11 20 6 ALA A 9 ? ? 82.12 160.75 21 6 ASP A 10 ? ? -65.76 94.16 22 6 ASN A 11 ? ? 67.21 136.93 23 6 LYS A 95 ? ? -121.26 -63.53 24 6 ASP A 98 ? ? -79.66 20.03 25 7 ASN A 5 ? ? 65.72 169.67 26 7 ALA A 9 ? ? 66.04 -175.12 27 7 GLU A 13 ? ? -52.33 -74.74 28 7 LYS A 95 ? ? -121.68 -64.75 29 7 ASP A 98 ? ? -88.62 38.32 30 8 SER A 2 ? ? 66.72 102.62 31 8 ASN A 5 ? ? -61.98 98.04 32 8 ALA A 9 ? ? 58.28 87.45 33 8 GLU A 112 ? ? -79.16 -169.93 34 9 ALA A 6 ? ? 54.79 -91.12 35 9 GLU A 7 ? ? 177.44 142.68 36 9 SER A 36 ? ? -96.98 -77.86 37 9 THR A 45 ? ? -138.23 -157.89 38 9 LYS A 95 ? ? -132.70 -57.63 39 9 GLU A 112 ? ? -93.83 -82.50 40 9 TYR A 113 ? ? -158.99 13.00 41 10 THR A 3 ? ? -122.50 -90.22 42 10 PHE A 4 ? ? -178.22 -90.21 43 10 ASP A 10 ? ? -78.01 -163.13 44 10 ASN A 11 ? ? 72.32 124.80 45 10 PRO A 38 ? ? -77.32 21.34 46 10 THR A 45 ? ? -135.15 -155.62 47 10 PHE A 101 ? ? -142.62 -67.10 48 11 SER A 2 ? ? -143.49 -142.95 49 11 THR A 8 ? ? -153.09 76.09 50 11 ASN A 11 ? ? 70.11 125.04 51 11 LYS A 95 ? ? -142.83 -66.63 52 11 ASN A 100 ? ? -113.89 74.59 53 12 SER A 2 ? ? 57.19 -155.93 54 12 ASN A 11 ? ? 68.36 112.95 55 12 LYS A 95 ? ? -130.88 -66.09 56 12 GLU A 112 ? ? -116.40 -169.93 57 13 SER A 2 ? ? -61.65 90.99 58 13 THR A 3 ? ? -150.80 24.53 59 13 ASP A 10 ? ? -68.61 86.78 60 13 LYS A 95 ? ? -107.15 -65.20 61 13 ASP A 98 ? ? -89.27 36.65 62 14 GLU A 7 ? ? -152.08 75.73 63 14 ASP A 10 ? ? -101.03 -65.93 64 14 THR A 45 ? ? -125.53 -147.95 65 14 LYS A 95 ? ? -137.99 -41.32 66 14 ASP A 98 ? ? -89.90 34.56 67 14 GLU A 112 ? ? -114.98 -111.34 68 14 TYR A 113 ? ? -150.99 64.27 69 15 THR A 3 ? ? 68.91 125.99 70 15 PHE A 4 ? ? -64.78 95.80 71 15 ALA A 9 ? ? -161.22 27.66 72 15 ASP A 10 ? ? -79.28 -160.71 73 15 GLU A 112 ? ? -111.66 -161.56 74 16 PRO A 38 ? ? -75.76 33.35 75 16 LEU A 44 ? ? -97.67 -64.28 76 16 PHE A 59 ? ? -119.18 77.75 77 16 LYS A 95 ? ? -130.17 -63.45 78 17 ASP A 10 ? ? -142.64 -93.39 79 17 GLU A 112 ? ? -108.71 -169.76 80 18 SER A 2 ? ? -90.33 50.52 81 18 ALA A 9 ? ? -177.05 -175.63 82 18 ASN A 11 ? ? 53.12 -155.59 83 18 GLU A 112 ? ? -107.39 -162.88 84 19 SER A 2 ? ? 70.67 146.05 85 19 ALA A 9 ? ? -130.28 -102.30 86 19 ASN A 11 ? ? 74.79 140.78 87 19 LYS A 95 ? ? -122.62 -66.50 88 20 ASN A 5 ? ? -168.35 115.97 89 20 ASP A 10 ? ? -75.12 -77.52 90 20 SER A 110 ? ? -91.56 30.29 #