data_2JZH # _entry.id 2JZH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JZH pdb_00002jzh 10.2210/pdb2jzh/pdb RCSB RCSB100484 ? ? WWPDB D_1000100484 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1PDO 'X-ray structure of IIAMannose' unspecified PDB 2JZN 'Structure of prodcutive IIAMannose(H10E)-IIBMannose complex' unspecified PDB 2JZO 'Structure of non-prodcutive IIAMannose(H10E)-IIBMannose complex' unspecified PDB 1VSQ 'Structure of prodcutive IIAMannose(H10E)-IIBMannose complex' unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JZH _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-01-08 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Komlosh, M.' 1 'Williams Jr., D.C.' 2 # _citation.id primary _citation.title ;Solution NMR Structures of Productive and Non-productive Complexes between the A and B Domains of the Cytoplasmic Subunit of the Mannose Transporter of the Escherichia coli Phosphotransferase System. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 283 _citation.page_first 11024 _citation.page_last 11037 _citation.year 2008 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18270202 _citation.pdbx_database_id_DOI 10.1074/jbc.M800312200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hu, J.' 1 ? primary 'Hu, K.' 2 ? primary 'Williams, D.C.' 3 ? primary 'Komlosh, M.E.' 4 ? primary 'Cai, M.' 5 ? primary 'Clore, G.M.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PTS system mannose-specific EIIAB component' _entity.formula_weight 19119.258 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.1.69 _entity.pdbx_mutation ? _entity.pdbx_fragment 'PTS EIIB type-4 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'EIIAB-Man, Mannose-specific phosphotransferase enzyme IIB component, PTS system mannose-specific EIIB component' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMKPMGPNDYMVIGLARIDDRLIHGQVATRWTKETNVSRIIVVSDEVAADTVRKTLLTQVAPPGVTAHVVDVAKMIRVY NNPKYAGERVMLLFTNPTDVERLVEGGVKITSVNVGGMAFRQGKTQVNNAVSVDEKDIEAFKKLNARGIELEVRKVSTDP KLKMMDLISKIDK ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMKPMGPNDYMVIGLARIDDRLIHGQVATRWTKETNVSRIIVVSDEVAADTVRKTLLTQVAPPGVTAHVVDVAKMIRVY NNPKYAGERVMLLFTNPTDVERLVEGGVKITSVNVGGMAFRQGKTQVNNAVSVDEKDIEAFKKLNARGIELEVRKVSTDP KLKMMDLISKIDK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 LYS n 1 5 PRO n 1 6 MET n 1 7 GLY n 1 8 PRO n 1 9 ASN n 1 10 ASP n 1 11 TYR n 1 12 MET n 1 13 VAL n 1 14 ILE n 1 15 GLY n 1 16 LEU n 1 17 ALA n 1 18 ARG n 1 19 ILE n 1 20 ASP n 1 21 ASP n 1 22 ARG n 1 23 LEU n 1 24 ILE n 1 25 HIS n 1 26 GLY n 1 27 GLN n 1 28 VAL n 1 29 ALA n 1 30 THR n 1 31 ARG n 1 32 TRP n 1 33 THR n 1 34 LYS n 1 35 GLU n 1 36 THR n 1 37 ASN n 1 38 VAL n 1 39 SER n 1 40 ARG n 1 41 ILE n 1 42 ILE n 1 43 VAL n 1 44 VAL n 1 45 SER n 1 46 ASP n 1 47 GLU n 1 48 VAL n 1 49 ALA n 1 50 ALA n 1 51 ASP n 1 52 THR n 1 53 VAL n 1 54 ARG n 1 55 LYS n 1 56 THR n 1 57 LEU n 1 58 LEU n 1 59 THR n 1 60 GLN n 1 61 VAL n 1 62 ALA n 1 63 PRO n 1 64 PRO n 1 65 GLY n 1 66 VAL n 1 67 THR n 1 68 ALA n 1 69 HIS n 1 70 VAL n 1 71 VAL n 1 72 ASP n 1 73 VAL n 1 74 ALA n 1 75 LYS n 1 76 MET n 1 77 ILE n 1 78 ARG n 1 79 VAL n 1 80 TYR n 1 81 ASN n 1 82 ASN n 1 83 PRO n 1 84 LYS n 1 85 TYR n 1 86 ALA n 1 87 GLY n 1 88 GLU n 1 89 ARG n 1 90 VAL n 1 91 MET n 1 92 LEU n 1 93 LEU n 1 94 PHE n 1 95 THR n 1 96 ASN n 1 97 PRO n 1 98 THR n 1 99 ASP n 1 100 VAL n 1 101 GLU n 1 102 ARG n 1 103 LEU n 1 104 VAL n 1 105 GLU n 1 106 GLY n 1 107 GLY n 1 108 VAL n 1 109 LYS n 1 110 ILE n 1 111 THR n 1 112 SER n 1 113 VAL n 1 114 ASN n 1 115 VAL n 1 116 GLY n 1 117 GLY n 1 118 MET n 1 119 ALA n 1 120 PHE n 1 121 ARG n 1 122 GLN n 1 123 GLY n 1 124 LYS n 1 125 THR n 1 126 GLN n 1 127 VAL n 1 128 ASN n 1 129 ASN n 1 130 ALA n 1 131 VAL n 1 132 SER n 1 133 VAL n 1 134 ASP n 1 135 GLU n 1 136 LYS n 1 137 ASP n 1 138 ILE n 1 139 GLU n 1 140 ALA n 1 141 PHE n 1 142 LYS n 1 143 LYS n 1 144 LEU n 1 145 ASN n 1 146 ALA n 1 147 ARG n 1 148 GLY n 1 149 ILE n 1 150 GLU n 1 151 LEU n 1 152 GLU n 1 153 VAL n 1 154 ARG n 1 155 LYS n 1 156 VAL n 1 157 SER n 1 158 THR n 1 159 ASP n 1 160 PRO n 1 161 LYS n 1 162 LEU n 1 163 LYS n 1 164 MET n 1 165 MET n 1 166 ASP n 1 167 LEU n 1 168 ILE n 1 169 SER n 1 170 LYS n 1 171 ILE n 1 172 ASP n 1 173 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene 'manX, gptB, ptsL' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET32a modified' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTNAB_ECOLI _struct_ref.pdbx_db_accession P69797 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KPMGPNDYMVIGLARIDDRLIHGQVATRWTKETNVSRIIVVSDEVAADTVRKTLLTQVAPPGVTAHVVDVAKMIRVYNNP KYAGERVMLLFTNPTDVERLVEGGVKITSVNVGGMAFRQGKTQVNNAVSVDEKDIEAFKKLNARGIELEVRKVSTDPKLK MMDLISKIDK ; _struct_ref.pdbx_align_begin 154 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JZH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 173 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P69797 _struct_ref_seq.db_align_beg 154 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 323 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 173 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JZH GLY A 1 ? UNP P69797 ? ? 'expression tag' 1 1 1 2JZH SER A 2 ? UNP P69797 ? ? 'expression tag' 2 2 1 2JZH MET A 3 ? UNP P69797 ? ? 'expression tag' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HCCH-TOCSY' 1 2 1 '3D HCCH-COSY' 1 3 1 '3D 1H-13C NOESY' 1 4 2 '2D 1H-15N HSQC' 1 5 2 '3D 1H-15N NOESY' 1 6 2 '3D CBCA(CO)NH' 1 7 2 '3D C(CO)NH' 1 8 2 '3D HNCACB' 1 9 2 '3D HBHA(CO)NH' 1 10 2 '3D H(CCO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5-1 mM [U-100% 13C; U-100% 15N] protein, sodium phosphate, sodium azide, 100% D2O' 1 '100% D2O' '0.5-1 mM [U-100% 15N] protein, sodium phosphate, sodium azide, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker DRX 1 'Bruker DRX' 800 Bruker DRX 2 'Bruker DRX' 500 Bruker DRX 3 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2JZH _pdbx_nmr_refine.method 'simulated annealing in torsion angle space' _pdbx_nmr_refine.details ;RMS DEVIATION FROM EXPERIMENTAL RESTRAINTS (NUNMER OF RESTRAINTS IN PARENTHESES): INTERPROTON DISTANCES (A) (1577) 0.008, TORSION ANGLES (DEG) (478) 0.26, 13CALPHA SHIFTS (PPM) (161) 1.25, 13CBETA SHIFTS (PPM) (158) 1.23. RDC R-factors (%): PHAGE 1DNH (151) 4.2, PHAGE 1DNC' (113) 18.2, PHAGE 2DHNC' (113) 16.5, PEG/HEXANOL 1DNH (141) 6.0, PEG/HEXANOL 1DNC' (96) 25.8, PEG/HEXANOL 2DHNC' (103) 23.5. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2JZH _pdbx_nmr_details.text ;Double and triple resonance 3D NMR experiments for assignments (HNCACB, CBCA(CO)NH, HBHA(CBCACO)NH, C(CCO)NH, H(CCO)NH, HCCH-COSY, HCCH-TOCSY). NOE-derived interproton distance restrants from 3D 15N-, 13C-, 13C/15M-, 13C/13C, and 15N/15N-separated NOE spectra. Side chain rotamers from 3H heteronuclear couplings and short mixing time 3D 13C-separated NOE and 3D 15N-seaparated ROE spectra. RDCs obtained by taking difference in J couplings in aligned (phage pf1 and PEG/hexanol) and isotopic media. ; # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures' _pdbx_nmr_ensemble.conformers_calculated_total_number 130 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JZH _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JZH _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Garrett and Clore' 'chemical shift assignment' PIPP ? 1 'Garrett and Clore' 'data analysis' PIPP ? 2 'Schwieters, Kuszewski and Clore' refinement 'X-PLOR NIH' 2.18.1 3 'Garrett and Clore' 'chemical shift assignment' CAPP ? 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JZH _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JZH _struct.title 'structure of IIB domain of the mannose transporter of E. coli' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2JZH _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;Mannose specific PTS system IIAB, IIB domain, IIBMan phosphotransferase enzyme II, B component, Cytoplasm, Membrane, Phosphoprotein, Phosphotransferase system, Sugar transport, Transport, TRANSFERASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 27 ? THR A 36 ? GLN A 27 THR A 36 1 ? 10 HELX_P HELX_P2 2 SER A 45 ? ALA A 50 ? SER A 45 ALA A 50 1 ? 6 HELX_P HELX_P3 3 ASP A 51 ? VAL A 61 ? ASP A 51 VAL A 61 1 ? 11 HELX_P HELX_P4 4 ASP A 72 ? ASN A 81 ? ASP A 72 ASN A 81 1 ? 10 HELX_P HELX_P5 5 ASN A 82 ? ALA A 86 ? ASN A 82 ALA A 86 5 ? 5 HELX_P HELX_P6 6 ASN A 96 ? GLY A 106 ? ASN A 96 GLY A 106 1 ? 11 HELX_P HELX_P7 7 ASP A 134 ? ARG A 147 ? ASP A 134 ARG A 147 1 ? 14 HELX_P HELX_P8 8 MET A 164 ? LYS A 170 ? MET A 164 LYS A 170 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 67 ? VAL A 71 ? THR A 67 VAL A 71 A 2 ARG A 40 ? VAL A 44 ? ARG A 40 VAL A 44 A 3 ARG A 89 ? PHE A 94 ? ARG A 89 PHE A 94 A 4 VAL A 13 ? ASP A 20 ? VAL A 13 ASP A 20 A 5 SER A 112 ? GLY A 117 ? SER A 112 GLY A 117 A 6 GLU A 150 ? VAL A 153 ? GLU A 150 VAL A 153 A 7 LEU A 162 ? LYS A 163 ? LEU A 162 LYS A 163 B 1 THR A 125 ? GLN A 126 ? THR A 125 GLN A 126 B 2 SER A 132 ? VAL A 133 ? SER A 132 VAL A 133 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O HIS A 69 ? O HIS A 69 N VAL A 43 ? N VAL A 43 A 2 3 N ILE A 42 ? N ILE A 42 O MET A 91 ? O MET A 91 A 3 4 O PHE A 94 ? O PHE A 94 N ASP A 20 ? N ASP A 20 A 4 5 N ALA A 17 ? N ALA A 17 O ASN A 114 ? O ASN A 114 A 5 6 N VAL A 113 ? N VAL A 113 O GLU A 150 ? O GLU A 150 A 6 7 N VAL A 153 ? N VAL A 153 O LEU A 162 ? O LEU A 162 B 1 2 N THR A 125 ? N THR A 125 O VAL A 133 ? O VAL A 133 # _atom_sites.entry_id 2JZH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 MET 3 3 ? ? ? A . n A 1 4 LYS 4 4 ? ? ? A . n A 1 5 PRO 5 5 ? ? ? A . n A 1 6 MET 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 PRO 8 8 ? ? ? A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 MET 164 164 164 MET MET A . n A 1 165 MET 165 165 165 MET MET A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 LYS 173 173 173 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-02-19 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.006 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.001 _pdbx_nmr_ensemble_rms.entry_id 2JZH _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate, sodium azide' 0.5 mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate, sodium azide' 0.5 mM '[U-100% 15N]' 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2JZH _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1467 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 451 _pdbx_nmr_constraints.NOE_long_range_total_count 339 _pdbx_nmr_constraints.NOE_medium_range_total_count 270 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 407 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 108 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 53 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 160 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 157 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD22 A ASN 9 ? ? HZ2 A LYS 109 ? ? 1.31 2 1 OD1 A ASP 134 ? ? H A ASP 137 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 10 ? ? -81.46 36.01 2 1 TYR A 11 ? ? -118.22 -134.77 3 1 LEU A 16 ? ? -171.94 147.53 4 1 ASP A 20 ? ? -163.74 115.33 5 1 LEU A 23 ? ? 59.02 -101.35 6 1 ALA A 130 ? ? -145.50 24.38 7 1 ILE A 171 ? ? -109.07 -66.10 # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id LYS _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 173 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id O _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id A _pdbx_unobs_or_zero_occ_atoms.label_comp_id LYS _pdbx_unobs_or_zero_occ_atoms.label_seq_id 173 _pdbx_unobs_or_zero_occ_atoms.label_atom_id O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A MET 3 ? A MET 3 4 1 Y 1 A LYS 4 ? A LYS 4 5 1 Y 1 A PRO 5 ? A PRO 5 6 1 Y 1 A MET 6 ? A MET 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A PRO 8 ? A PRO 8 #