data_2K3R # _entry.id 2K3R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K3R pdb_00002k3r 10.2210/pdb2k3r/pdb RCSB RCSB100638 ? ? WWPDB D_1000100638 ? ? BMRB 15776 ? 10.13018/BMR15776 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-12-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 4 'Structure model' database_2 10 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K3R _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-05-15 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 15776 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Amero, C.D.' 1 'Foster, M.P.' 2 'Boomershine, W.P.' 3 'Xu, Y.' 4 # _citation.id primary _citation.title ;Solution structure of Pyrococcus furiosus RPP21, a component of the archaeal RNase P holoenzyme, and interactions with its RPP29 protein partner. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 47 _citation.page_first 11704 _citation.page_last 11710 _citation.year 2008 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18922021 _citation.pdbx_database_id_DOI 10.1021/bi8015982 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Amero, C.D.' 1 ? primary 'Boomershine, W.P.' 2 ? primary 'Xu, Y.' 3 ? primary 'Foster, M.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ribonuclease P protein component 4' 14922.226 1 3.1.26.5 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNase P component 4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAKYNEKKEKKRIAKERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCKKCHAFLVPGINARVRL RQKRMPHIVVKCLECGHIMRYPYIKEIKKRRKEKMEYGGLVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;MAKYNEKKEKKRIAKERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCKKCHAFLVPGINARVRL RQKRMPHIVVKCLECGHIMRYPYIKEIKKRRKEKMEYGGLVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 LYS n 1 4 TYR n 1 5 ASN n 1 6 GLU n 1 7 LYS n 1 8 LYS n 1 9 GLU n 1 10 LYS n 1 11 LYS n 1 12 ARG n 1 13 ILE n 1 14 ALA n 1 15 LYS n 1 16 GLU n 1 17 ARG n 1 18 ILE n 1 19 ASP n 1 20 ILE n 1 21 LEU n 1 22 PHE n 1 23 SER n 1 24 LEU n 1 25 ALA n 1 26 GLU n 1 27 ARG n 1 28 VAL n 1 29 PHE n 1 30 PRO n 1 31 TYR n 1 32 SER n 1 33 PRO n 1 34 GLU n 1 35 LEU n 1 36 ALA n 1 37 LYS n 1 38 ARG n 1 39 TYR n 1 40 VAL n 1 41 GLU n 1 42 LEU n 1 43 ALA n 1 44 LEU n 1 45 LEU n 1 46 VAL n 1 47 GLN n 1 48 GLN n 1 49 LYS n 1 50 ALA n 1 51 LYS n 1 52 VAL n 1 53 LYS n 1 54 ILE n 1 55 PRO n 1 56 ARG n 1 57 LYS n 1 58 TRP n 1 59 LYS n 1 60 ARG n 1 61 ARG n 1 62 TYR n 1 63 CYS n 1 64 LYS n 1 65 LYS n 1 66 CYS n 1 67 HIS n 1 68 ALA n 1 69 PHE n 1 70 LEU n 1 71 VAL n 1 72 PRO n 1 73 GLY n 1 74 ILE n 1 75 ASN n 1 76 ALA n 1 77 ARG n 1 78 VAL n 1 79 ARG n 1 80 LEU n 1 81 ARG n 1 82 GLN n 1 83 LYS n 1 84 ARG n 1 85 MET n 1 86 PRO n 1 87 HIS n 1 88 ILE n 1 89 VAL n 1 90 VAL n 1 91 LYS n 1 92 CYS n 1 93 LEU n 1 94 GLU n 1 95 CYS n 1 96 GLY n 1 97 HIS n 1 98 ILE n 1 99 MET n 1 100 ARG n 1 101 TYR n 1 102 PRO n 1 103 TYR n 1 104 ILE n 1 105 LYS n 1 106 GLU n 1 107 ILE n 1 108 LYS n 1 109 LYS n 1 110 ARG n 1 111 ARG n 1 112 LYS n 1 113 GLU n 1 114 LYS n 1 115 MET n 1 116 GLU n 1 117 TYR n 1 118 GLY n 1 119 GLY n 1 120 LEU n 1 121 VAL n 1 122 PRO n 1 123 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rnp4, PF1613' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2261 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-33b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 TYR 4 4 ? ? ? A . n A 1 5 ASN 5 5 ? ? ? A . n A 1 6 GLU 6 6 ? ? ? A . n A 1 7 LYS 7 7 ? ? ? A . n A 1 8 LYS 8 8 ? ? ? A . n A 1 9 GLU 9 9 ? ? ? A . n A 1 10 LYS 10 10 ? ? ? A . n A 1 11 LYS 11 11 ? ? ? A . n A 1 12 ARG 12 12 ? ? ? A . n A 1 13 ILE 13 13 ? ? ? A . n A 1 14 ALA 14 14 ? ? ? A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 CYS 92 92 92 CYS CYS A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 MET 99 99 99 MET MET A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 GLU 106 106 ? ? ? A . n A 1 107 ILE 107 107 ? ? ? A . n A 1 108 LYS 108 108 ? ? ? A . n A 1 109 LYS 109 109 ? ? ? A . n A 1 110 ARG 110 110 ? ? ? A . n A 1 111 ARG 111 111 ? ? ? A . n A 1 112 LYS 112 112 ? ? ? A . n A 1 113 GLU 113 113 ? ? ? A . n A 1 114 LYS 114 114 ? ? ? A . n A 1 115 MET 115 115 ? ? ? A . n A 1 116 GLU 116 116 ? ? ? A . n A 1 117 TYR 117 117 ? ? ? A . n A 1 118 GLY 118 118 ? ? ? A . n A 1 119 GLY 119 119 ? ? ? A . n A 1 120 LEU 120 120 ? ? ? A . n A 1 121 VAL 121 121 ? ? ? A . n A 1 122 PRO 122 122 ? ? ? A . n A 1 123 ARG 123 123 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 124 _pdbx_nonpoly_scheme.auth_seq_num 124 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 2K3R _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2K3R _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K3R _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K3R _struct.title 'Pfu Rpp21 structure and assignments' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K3R _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'Pfu Rpp21, RNase P, Hydrolase, tRNA processing' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RNP4_PYRFU _struct_ref.pdbx_db_accession Q8U0H6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAKYNEKKEKKRIAKERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCKKCHAFLVPGINARVRL RQKRMPHIVVKCLECGHIMRYPYIKEIKKRRKEKMEY ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K3R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 117 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8U0H6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 117 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 117 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K3R GLY A 118 ? UNP Q8U0H6 ? ? 'expression tag' 118 1 1 2K3R GLY A 119 ? UNP Q8U0H6 ? ? 'expression tag' 119 2 1 2K3R LEU A 120 ? UNP Q8U0H6 ? ? 'expression tag' 120 3 1 2K3R VAL A 121 ? UNP Q8U0H6 ? ? 'expression tag' 121 4 1 2K3R PRO A 122 ? UNP Q8U0H6 ? ? 'expression tag' 122 5 1 2K3R ARG A 123 ? UNP Q8U0H6 ? ? 'expression tag' 123 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 15 ? SER A 32 ? LYS A 15 SER A 32 1 ? 18 HELX_P HELX_P2 2 SER A 32 ? LYS A 51 ? SER A 32 LYS A 51 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 63 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 63 A ZN 124 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc2 metalc ? ? A CYS 66 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 66 A ZN 124 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc3 metalc ? ? A CYS 92 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 92 A ZN 124 1_555 ? ? ? ? ? ? ? 2.291 ? ? metalc4 metalc ? ? A CYS 95 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 95 A ZN 124 1_555 ? ? ? ? ? ? ? 2.295 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 63 ? A CYS 63 ? 1_555 ZN ? B ZN . ? A ZN 124 ? 1_555 SG ? A CYS 66 ? A CYS 66 ? 1_555 111.9 ? 2 SG ? A CYS 63 ? A CYS 63 ? 1_555 ZN ? B ZN . ? A ZN 124 ? 1_555 SG ? A CYS 92 ? A CYS 92 ? 1_555 110.6 ? 3 SG ? A CYS 66 ? A CYS 66 ? 1_555 ZN ? B ZN . ? A ZN 124 ? 1_555 SG ? A CYS 92 ? A CYS 92 ? 1_555 114.1 ? 4 SG ? A CYS 63 ? A CYS 63 ? 1_555 ZN ? B ZN . ? A ZN 124 ? 1_555 SG ? A CYS 95 ? A CYS 95 ? 1_555 109.8 ? 5 SG ? A CYS 66 ? A CYS 66 ? 1_555 ZN ? B ZN . ? A ZN 124 ? 1_555 SG ? A CYS 95 ? A CYS 95 ? 1_555 104.3 ? 6 SG ? A CYS 92 ? A CYS 92 ? 1_555 ZN ? B ZN . ? A ZN 124 ? 1_555 SG ? A CYS 95 ? A CYS 95 ? 1_555 105.8 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 76 ? ARG A 81 ? ALA A 76 ARG A 81 A 2 HIS A 87 ? CYS A 92 ? HIS A 87 CYS A 92 A 3 ILE A 98 ? PRO A 102 ? ILE A 98 PRO A 102 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 77 ? N ARG A 77 O LYS A 91 ? O LYS A 91 A 2 3 N VAL A 90 ? N VAL A 90 O MET A 99 ? O MET A 99 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 124 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 124' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 CYS A 63 ? CYS A 63 . ? 1_555 ? 2 AC1 2 CYS A 92 ? CYS A 92 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 H A VAL 90 ? ? O A MET 99 ? ? 1.58 2 4 H A VAL 90 ? ? O A MET 99 ? ? 1.60 3 9 O A VAL 90 ? ? H A MET 99 ? ? 1.58 4 11 O A ASN 75 ? ? H A LEU 93 ? ? 1.59 5 13 O A VAL 90 ? ? H A MET 99 ? ? 1.55 6 14 O A VAL 90 ? ? H A MET 99 ? ? 1.60 7 16 HZ3 A LYS 37 ? ? O A CYS 66 ? ? 1.54 8 16 O A VAL 90 ? ? H A MET 99 ? ? 1.57 9 17 O A VAL 46 ? ? H A ALA 50 ? ? 1.57 10 19 O A VAL 90 ? ? H A MET 99 ? ? 1.58 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 4 CB A TYR 62 ? ? CG A TYR 62 ? ? CD2 A TYR 62 ? ? 116.98 121.00 -4.02 0.60 N 2 10 CB A TYR 62 ? ? CG A TYR 62 ? ? CD2 A TYR 62 ? ? 116.85 121.00 -4.15 0.60 N 3 12 CB A TYR 62 ? ? CG A TYR 62 ? ? CD2 A TYR 62 ? ? 116.98 121.00 -4.02 0.60 N 4 13 CB A PHE 29 ? ? CG A PHE 29 ? ? CD2 A PHE 29 ? ? 115.77 120.80 -5.03 0.70 N 5 14 CB A TYR 62 ? ? CG A TYR 62 ? ? CD2 A TYR 62 ? ? 117.13 121.00 -3.87 0.60 N 6 18 CB A TYR 62 ? ? CG A TYR 62 ? ? CD2 A TYR 62 ? ? 116.63 121.00 -4.37 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 32 ? ? -163.46 115.14 2 1 PRO A 55 ? ? -54.49 -101.88 3 1 ILE A 74 ? ? -109.62 -74.37 4 2 ILE A 74 ? ? -105.79 -75.53 5 2 GLN A 82 ? ? -65.93 -168.25 6 2 ARG A 84 ? ? -125.83 -153.02 7 3 SER A 32 ? ? -164.32 117.37 8 3 ARG A 56 ? ? -137.11 -33.19 9 3 ILE A 74 ? ? -101.95 -75.11 10 4 SER A 32 ? ? -164.85 116.23 11 4 ARG A 56 ? ? -137.00 -31.83 12 4 ILE A 74 ? ? -103.76 -75.17 13 4 GLN A 82 ? ? -111.51 68.39 14 5 ILE A 74 ? ? -104.42 -74.55 15 5 GLN A 82 ? ? -113.02 68.29 16 6 ILE A 74 ? ? -104.71 -74.45 17 6 ARG A 84 ? ? -74.81 -166.36 18 7 ARG A 56 ? ? -136.68 -41.31 19 7 ILE A 74 ? ? -101.18 -75.07 20 8 SER A 32 ? ? -165.11 116.21 21 8 ILE A 74 ? ? -107.09 -75.03 22 9 ILE A 74 ? ? -111.48 -74.01 23 10 ILE A 74 ? ? -105.91 -75.03 24 11 ILE A 74 ? ? -112.64 -74.84 25 12 SER A 32 ? ? -164.83 111.77 26 12 ILE A 74 ? ? -106.14 -74.01 27 13 SER A 32 ? ? -164.35 114.03 28 13 ILE A 74 ? ? -108.14 -74.75 29 13 GLN A 82 ? ? -118.23 68.40 30 14 SER A 32 ? ? -163.65 113.67 31 14 ILE A 74 ? ? -106.88 -74.32 32 15 SER A 32 ? ? -164.63 114.95 33 15 HIS A 67 ? ? 65.90 -1.88 34 15 ILE A 74 ? ? -105.97 -75.31 35 16 ILE A 74 ? ? -112.81 -74.29 36 17 SER A 32 ? ? -165.62 119.30 37 17 ILE A 74 ? ? -103.78 -74.49 38 18 ILE A 74 ? ? -114.29 -74.27 39 18 GLN A 82 ? ? -113.88 69.16 40 19 ARG A 56 ? ? -137.22 -40.57 41 19 ILE A 74 ? ? -105.78 -73.81 42 19 GLN A 82 ? ? -118.96 67.10 43 20 SER A 32 ? ? -164.81 117.57 44 20 ILE A 74 ? ? -105.60 -74.82 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ARG A 84 ? ? MET A 85 ? ? 138.99 2 2 MET A 85 ? ? PRO A 86 ? ? -147.40 3 3 ARG A 84 ? ? MET A 85 ? ? 138.15 4 4 ARG A 84 ? ? MET A 85 ? ? 140.86 5 5 ARG A 84 ? ? MET A 85 ? ? 143.62 6 6 ARG A 84 ? ? MET A 85 ? ? -117.08 7 6 MET A 85 ? ? PRO A 86 ? ? -126.28 8 7 ARG A 84 ? ? MET A 85 ? ? 139.83 9 8 ARG A 84 ? ? MET A 85 ? ? 146.28 10 9 ARG A 84 ? ? MET A 85 ? ? 146.32 11 10 ARG A 84 ? ? MET A 85 ? ? 143.24 12 11 ARG A 84 ? ? MET A 85 ? ? 141.04 13 14 ARG A 84 ? ? MET A 85 ? ? 143.60 14 15 ARG A 84 ? ? MET A 85 ? ? 142.33 15 16 ARG A 84 ? ? MET A 85 ? ? 147.82 16 17 ARG A 84 ? ? MET A 85 ? ? 144.39 17 18 ARG A 84 ? ? MET A 85 ? ? 129.52 18 20 ARG A 84 ? ? MET A 85 ? ? 145.68 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 PHE A 29 ? ? 0.086 'SIDE CHAIN' 2 1 PHE A 69 ? ? 0.098 'SIDE CHAIN' 3 1 ARG A 79 ? ? 0.097 'SIDE CHAIN' 4 1 HIS A 97 ? ? 0.091 'SIDE CHAIN' 5 2 PHE A 22 ? ? 0.084 'SIDE CHAIN' 6 2 PHE A 29 ? ? 0.112 'SIDE CHAIN' 7 2 TYR A 31 ? ? 0.069 'SIDE CHAIN' 8 2 TYR A 62 ? ? 0.079 'SIDE CHAIN' 9 2 PHE A 69 ? ? 0.081 'SIDE CHAIN' 10 2 ARG A 81 ? ? 0.082 'SIDE CHAIN' 11 2 ARG A 84 ? ? 0.114 'SIDE CHAIN' 12 3 PHE A 29 ? ? 0.094 'SIDE CHAIN' 13 3 TYR A 62 ? ? 0.076 'SIDE CHAIN' 14 3 PHE A 69 ? ? 0.108 'SIDE CHAIN' 15 3 HIS A 87 ? ? 0.127 'SIDE CHAIN' 16 3 HIS A 97 ? ? 0.075 'SIDE CHAIN' 17 3 TYR A 101 ? ? 0.076 'SIDE CHAIN' 18 4 PHE A 22 ? ? 0.082 'SIDE CHAIN' 19 4 PHE A 29 ? ? 0.105 'SIDE CHAIN' 20 4 TYR A 39 ? ? 0.068 'SIDE CHAIN' 21 4 TYR A 62 ? ? 0.074 'SIDE CHAIN' 22 4 PHE A 69 ? ? 0.075 'SIDE CHAIN' 23 4 HIS A 87 ? ? 0.114 'SIDE CHAIN' 24 5 PHE A 29 ? ? 0.082 'SIDE CHAIN' 25 5 TYR A 31 ? ? 0.080 'SIDE CHAIN' 26 5 GLU A 41 ? ? 0.086 'SIDE CHAIN' 27 5 TYR A 62 ? ? 0.081 'SIDE CHAIN' 28 5 PHE A 69 ? ? 0.075 'SIDE CHAIN' 29 5 HIS A 87 ? ? 0.097 'SIDE CHAIN' 30 6 PHE A 22 ? ? 0.084 'SIDE CHAIN' 31 6 PHE A 29 ? ? 0.092 'SIDE CHAIN' 32 6 TYR A 39 ? ? 0.072 'SIDE CHAIN' 33 6 TYR A 62 ? ? 0.069 'SIDE CHAIN' 34 6 PHE A 69 ? ? 0.103 'SIDE CHAIN' 35 6 ARG A 77 ? ? 0.112 'SIDE CHAIN' 36 6 ARG A 79 ? ? 0.099 'SIDE CHAIN' 37 7 PHE A 22 ? ? 0.086 'SIDE CHAIN' 38 7 PHE A 29 ? ? 0.111 'SIDE CHAIN' 39 7 GLU A 41 ? ? 0.103 'SIDE CHAIN' 40 7 ARG A 60 ? ? 0.118 'SIDE CHAIN' 41 7 PHE A 69 ? ? 0.107 'SIDE CHAIN' 42 7 ARG A 77 ? ? 0.129 'SIDE CHAIN' 43 7 ARG A 81 ? ? 0.152 'SIDE CHAIN' 44 7 HIS A 87 ? ? 0.151 'SIDE CHAIN' 45 8 PHE A 29 ? ? 0.116 'SIDE CHAIN' 46 8 GLU A 41 ? ? 0.079 'SIDE CHAIN' 47 8 TYR A 62 ? ? 0.067 'SIDE CHAIN' 48 8 PHE A 69 ? ? 0.099 'SIDE CHAIN' 49 8 ARG A 77 ? ? 0.149 'SIDE CHAIN' 50 8 ARG A 84 ? ? 0.072 'SIDE CHAIN' 51 8 HIS A 87 ? ? 0.084 'SIDE CHAIN' 52 8 GLU A 94 ? ? 0.082 'SIDE CHAIN' 53 9 PHE A 22 ? ? 0.069 'SIDE CHAIN' 54 9 PHE A 29 ? ? 0.088 'SIDE CHAIN' 55 9 TYR A 62 ? ? 0.112 'SIDE CHAIN' 56 9 PHE A 69 ? ? 0.070 'SIDE CHAIN' 57 9 ARG A 77 ? ? 0.113 'SIDE CHAIN' 58 9 ARG A 79 ? ? 0.110 'SIDE CHAIN' 59 9 HIS A 87 ? ? 0.120 'SIDE CHAIN' 60 10 PHE A 29 ? ? 0.102 'SIDE CHAIN' 61 10 TYR A 62 ? ? 0.085 'SIDE CHAIN' 62 10 HIS A 87 ? ? 0.072 'SIDE CHAIN' 63 11 PHE A 22 ? ? 0.117 'SIDE CHAIN' 64 11 PHE A 29 ? ? 0.181 'SIDE CHAIN' 65 11 ARG A 61 ? ? 0.111 'SIDE CHAIN' 66 11 PHE A 69 ? ? 0.122 'SIDE CHAIN' 67 11 HIS A 87 ? ? 0.141 'SIDE CHAIN' 68 12 PHE A 29 ? ? 0.114 'SIDE CHAIN' 69 12 GLU A 41 ? ? 0.080 'SIDE CHAIN' 70 12 TYR A 62 ? ? 0.118 'SIDE CHAIN' 71 12 HIS A 67 ? ? 0.062 'SIDE CHAIN' 72 12 PHE A 69 ? ? 0.108 'SIDE CHAIN' 73 12 TYR A 103 ? ? 0.080 'SIDE CHAIN' 74 13 PHE A 29 ? ? 0.095 'SIDE CHAIN' 75 13 GLU A 41 ? ? 0.072 'SIDE CHAIN' 76 13 TYR A 62 ? ? 0.067 'SIDE CHAIN' 77 13 PHE A 69 ? ? 0.080 'SIDE CHAIN' 78 13 ARG A 79 ? ? 0.138 'SIDE CHAIN' 79 13 HIS A 87 ? ? 0.095 'SIDE CHAIN' 80 14 PHE A 22 ? ? 0.123 'SIDE CHAIN' 81 14 PHE A 29 ? ? 0.077 'SIDE CHAIN' 82 14 HIS A 67 ? ? 0.064 'SIDE CHAIN' 83 14 PHE A 69 ? ? 0.089 'SIDE CHAIN' 84 14 ARG A 79 ? ? 0.099 'SIDE CHAIN' 85 15 PHE A 29 ? ? 0.117 'SIDE CHAIN' 86 15 ARG A 61 ? ? 0.116 'SIDE CHAIN' 87 15 TYR A 62 ? ? 0.084 'SIDE CHAIN' 88 15 HIS A 67 ? ? 0.095 'SIDE CHAIN' 89 15 PHE A 69 ? ? 0.112 'SIDE CHAIN' 90 15 ARG A 81 ? ? 0.099 'SIDE CHAIN' 91 15 GLU A 94 ? ? 0.088 'SIDE CHAIN' 92 15 TYR A 103 ? ? 0.106 'SIDE CHAIN' 93 16 PHE A 29 ? ? 0.145 'SIDE CHAIN' 94 16 PHE A 69 ? ? 0.094 'SIDE CHAIN' 95 16 GLU A 94 ? ? 0.070 'SIDE CHAIN' 96 16 HIS A 97 ? ? 0.086 'SIDE CHAIN' 97 16 TYR A 103 ? ? 0.134 'SIDE CHAIN' 98 17 PHE A 29 ? ? 0.124 'SIDE CHAIN' 99 17 ARG A 61 ? ? 0.076 'SIDE CHAIN' 100 17 PHE A 69 ? ? 0.090 'SIDE CHAIN' 101 17 GLU A 94 ? ? 0.074 'SIDE CHAIN' 102 18 PHE A 29 ? ? 0.142 'SIDE CHAIN' 103 18 TYR A 62 ? ? 0.110 'SIDE CHAIN' 104 18 PHE A 69 ? ? 0.110 'SIDE CHAIN' 105 19 PHE A 29 ? ? 0.173 'SIDE CHAIN' 106 19 TYR A 62 ? ? 0.071 'SIDE CHAIN' 107 19 PHE A 69 ? ? 0.103 'SIDE CHAIN' 108 19 ARG A 81 ? ? 0.108 'SIDE CHAIN' 109 19 GLU A 94 ? ? 0.070 'SIDE CHAIN' 110 20 PHE A 29 ? ? 0.081 'SIDE CHAIN' 111 20 TYR A 31 ? ? 0.064 'SIDE CHAIN' 112 20 TYR A 39 ? ? 0.087 'SIDE CHAIN' 113 20 PHE A 69 ? ? 0.110 'SIDE CHAIN' 114 20 HIS A 97 ? ? 0.085 'SIDE CHAIN' 115 20 TYR A 101 ? ? 0.064 'SIDE CHAIN' 116 20 TYR A 103 ? ? 0.137 'SIDE CHAIN' # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 HIS A 67 ? ? 16.59 2 1 ARG A 84 ? ? -12.90 3 1 VAL A 90 ? ? -10.45 4 2 GLU A 16 ? ? 11.79 5 2 LEU A 35 ? ? -10.34 6 2 HIS A 67 ? ? 15.93 7 2 ALA A 68 ? ? -14.16 8 2 LYS A 83 ? ? -10.80 9 2 MET A 85 ? ? 11.96 10 3 ARG A 17 ? ? -10.13 11 3 LEU A 35 ? ? -10.97 12 3 LYS A 57 ? ? 10.02 13 3 CYS A 66 ? ? 13.31 14 3 HIS A 67 ? ? 18.60 15 3 PHE A 69 ? ? 11.70 16 3 VAL A 90 ? ? -10.15 17 3 LYS A 91 ? ? -10.27 18 4 TYR A 62 ? ? 10.00 19 4 CYS A 66 ? ? 10.81 20 4 ARG A 84 ? ? -12.60 21 4 VAL A 90 ? ? -10.66 22 5 GLU A 26 ? ? 10.24 23 5 LEU A 35 ? ? -10.15 24 5 GLU A 41 ? ? -11.57 25 5 PRO A 55 ? ? 14.20 26 5 LYS A 59 ? ? 10.82 27 5 CYS A 66 ? ? 11.57 28 5 HIS A 67 ? ? 18.16 29 5 ARG A 84 ? ? -12.95 30 6 VAL A 28 ? ? 11.79 31 6 LEU A 35 ? ? -12.39 32 6 GLU A 41 ? ? -13.76 33 6 CYS A 66 ? ? 16.25 34 6 HIS A 67 ? ? 17.78 35 6 GLN A 82 ? ? 10.48 36 6 LYS A 83 ? ? 11.06 37 6 PRO A 86 ? ? 10.20 38 6 VAL A 89 ? ? -10.35 39 7 GLU A 26 ? ? 10.07 40 7 LEU A 35 ? ? -13.25 41 7 LYS A 59 ? ? 10.43 42 7 CYS A 66 ? ? 14.05 43 7 HIS A 67 ? ? 18.16 44 7 ALA A 68 ? ? -10.76 45 7 ARG A 84 ? ? -13.29 46 7 VAL A 90 ? ? -10.78 47 7 CYS A 95 ? ? -10.76 48 8 ARG A 17 ? ? -10.21 49 8 PRO A 33 ? ? -10.58 50 8 GLU A 41 ? ? -10.71 51 8 LYS A 59 ? ? 11.02 52 8 CYS A 63 ? ? -10.19 53 8 HIS A 67 ? ? 19.73 54 8 GLN A 82 ? ? -10.69 55 8 ARG A 84 ? ? -13.39 56 8 PRO A 86 ? ? -12.36 57 8 VAL A 90 ? ? -10.58 58 8 CYS A 92 ? ? -10.19 59 9 LEU A 35 ? ? -10.00 60 9 GLU A 41 ? ? -10.22 61 9 TRP A 58 ? ? -11.54 62 9 CYS A 66 ? ? 10.45 63 9 HIS A 67 ? ? 16.61 64 9 ARG A 84 ? ? -12.29 65 9 ILE A 98 ? ? 10.77 66 10 LEU A 35 ? ? -10.58 67 10 GLU A 41 ? ? -15.22 68 10 LYS A 59 ? ? 10.41 69 10 CYS A 66 ? ? 10.20 70 10 HIS A 67 ? ? 16.21 71 10 ALA A 68 ? ? -10.83 72 10 GLN A 82 ? ? -10.34 73 10 ARG A 84 ? ? -11.72 74 10 VAL A 90 ? ? -11.04 75 11 GLU A 41 ? ? -13.34 76 11 LYS A 59 ? ? 11.52 77 11 HIS A 67 ? ? 16.16 78 11 ALA A 68 ? ? -11.08 79 11 ARG A 84 ? ? -12.49 80 12 GLU A 41 ? ? -12.33 81 12 PRO A 55 ? ? 10.92 82 12 TYR A 62 ? ? 11.73 83 12 CYS A 66 ? ? 11.82 84 12 ARG A 84 ? ? -11.53 85 12 ILE A 98 ? ? 10.08 86 12 ILE A 104 ? ? 12.09 87 13 GLU A 41 ? ? -14.03 88 13 TRP A 58 ? ? -10.36 89 13 CYS A 66 ? ? 16.67 90 13 HIS A 67 ? ? 17.32 91 13 ASN A 75 ? ? -14.21 92 14 LEU A 35 ? ? -12.24 93 14 TYR A 39 ? ? 11.27 94 14 TRP A 58 ? ? -10.67 95 14 TYR A 62 ? ? 12.44 96 14 CYS A 66 ? ? 11.00 97 14 HIS A 67 ? ? -12.12 98 14 ARG A 84 ? ? -13.50 99 14 PRO A 86 ? ? -10.63 100 15 LEU A 35 ? ? -11.00 101 15 TYR A 62 ? ? 10.32 102 15 HIS A 67 ? ? -12.38 103 15 LEU A 70 ? ? -10.63 104 15 ASN A 75 ? ? -14.17 105 15 GLN A 82 ? ? 11.62 106 15 ARG A 84 ? ? -11.63 107 15 LYS A 91 ? ? -11.37 108 15 CYS A 92 ? ? -12.58 109 16 ARG A 17 ? ? -11.34 110 16 GLU A 41 ? ? -11.91 111 16 TRP A 58 ? ? -10.23 112 16 TYR A 62 ? ? 12.83 113 16 HIS A 67 ? ? -10.44 114 16 PHE A 69 ? ? 11.48 115 16 ARG A 84 ? ? -14.12 116 17 GLU A 26 ? ? 10.10 117 17 PRO A 33 ? ? -10.18 118 17 GLU A 41 ? ? -11.98 119 17 LYS A 57 ? ? 10.34 120 17 CYS A 63 ? ? -11.67 121 17 HIS A 67 ? ? 19.30 122 17 ARG A 84 ? ? -11.54 123 17 CYS A 95 ? ? -10.41 124 18 LEU A 35 ? ? -10.95 125 18 GLU A 41 ? ? -12.35 126 18 TYR A 62 ? ? 10.20 127 18 CYS A 66 ? ? 10.97 128 18 GLN A 82 ? ? 12.52 129 18 ARG A 84 ? ? -10.68 130 19 PRO A 33 ? ? -13.44 131 19 LEU A 35 ? ? -13.84 132 19 TYR A 39 ? ? 11.52 133 19 LYS A 57 ? ? 12.29 134 19 CYS A 63 ? ? -10.82 135 19 HIS A 67 ? ? 20.81 136 19 ALA A 68 ? ? -11.32 137 19 PHE A 69 ? ? 11.90 138 19 ARG A 84 ? ? -10.52 139 19 CYS A 95 ? ? -11.09 140 19 ILE A 98 ? ? 10.17 141 20 LEU A 21 ? ? -10.50 142 20 LEU A 35 ? ? -11.05 143 20 TYR A 39 ? ? 10.57 144 20 CYS A 66 ? ? 15.48 145 20 HIS A 67 ? ? 20.50 146 20 PHE A 69 ? ? 12.97 147 20 ARG A 84 ? ? -12.66 148 20 VAL A 90 ? ? -10.13 149 20 ILE A 104 ? ? -10.93 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K3R _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K3R _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;10 mM [U-99% 2H] TRIS, 10 mM potassium chloride, 0.02 % sodium azide, 1 mM [U-100% 13C; U-100% 15N] Rpp21, 0.3 mM ZINC chloride, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;10 mM [U-99% 2H] TRIS, 10 mM potassium chloride, 0.02 % sodium azide, 0.5 mM [U-100% 13C; U-100% 15N] Rpp21, 0.3 mM ZINC chloride, 0.5 mM Rpp29, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' ;10 mM [U-99% 2H] TRIS, 10 mM potassium chloride, 0.02 % sodium azide, 1 mM [U-100% 13C; U-100% 15N] Rpp21, 0.3 mM ZINC chloride, 100% D2O ; 3 '100% D2O' ;10 mM [U-99% 2H] TRIS, 10 mM potassium chloride, 0.02 % sodium azide, 1 mM [U-100% 13C; U-100% 15N] Rpp21, 0.3 mM cobalt chloride, 100% D2O ; 4 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id TRIS 10 mM '[U-99% 2H]' 1 'potassium chloride' 10 mM ? 1 'sodium azide' 0.02 % ? 1 Rpp21 1 mM '[U-100% 13C; U-100% 15N]' 1 'ZINC chloride' 0.3 mM ? 1 TRIS 10 mM '[U-99% 2H]' 2 'potassium chloride' 10 mM ? 2 'sodium azide' 0.02 % ? 2 Rpp21 0.5 mM '[U-100% 13C; U-100% 15N]' 2 'ZINC chloride' 0.3 mM ? 2 Rpp29 0.5 mM ? 2 TRIS 10 mM '[U-99% 2H]' 3 'potassium chloride' 10 mM ? 3 'sodium azide' 0.02 % ? 3 Rpp21 1 mM '[U-100% 13C; U-100% 15N]' 3 'ZINC chloride' 0.3 mM ? 3 TRIS 10 mM '[U-99% 2H]' 4 'potassium chloride' 10 mM ? 4 'sodium azide' 0.02 % ? 4 Rpp21 1 mM '[U-100% 13C; U-100% 15N]' 4 'cobalt chloride' 0.3 mM ? 4 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 10 _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 323 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCO' 1 3 1 '3D HNCA' 1 4 1 '3D HNCACB' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D 1H-15N TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' 1 9 3 '3D 1H-13C NOESY' 1 10 1 '3D HBHA(CO)NH' 1 11 1 '3D HCCH-COSY' 1 12 1 '3D HCCH-TOCSY' 1 13 2 '2D 1H-15N HSQC' 1 14 2 '3D HNCO' 1 15 2 '3D HNCA' 1 16 2 '3D HNCACB' 1 17 2 '3D CBCA(CO)NH' 1 18 4 '2D 1H-15N HSQC' 1 19 4 '3D HNCO' 1 20 4 '3D HNCA' 1 21 4 '3D HNCACB' 1 22 4 '3D 1H-15N NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2K3R _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1352 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 515 _pdbx_nmr_constraints.NOE_long_range_total_count 302 _pdbx_nmr_constraints.NOE_medium_range_total_count 154 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 381 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2K3R _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 1 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 2 'Schwieters, Kuszewski, Tjandra and Clore' 'geometry optimization' 'X-PLOR NIH' ? 3 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 4 'Johnson, One Moon Scientific' 'structure solution' NMRView ? 5 'Keller and Wuthrich' 'data analysis' CARA ? 6 'Keller and Wuthrich' 'structure solution' CARA ? 7 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 8 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A TYR 4 ? A TYR 4 5 1 Y 1 A ASN 5 ? A ASN 5 6 1 Y 1 A GLU 6 ? A GLU 6 7 1 Y 1 A LYS 7 ? A LYS 7 8 1 Y 1 A LYS 8 ? A LYS 8 9 1 Y 1 A GLU 9 ? A GLU 9 10 1 Y 1 A LYS 10 ? A LYS 10 11 1 Y 1 A LYS 11 ? A LYS 11 12 1 Y 1 A ARG 12 ? A ARG 12 13 1 Y 1 A ILE 13 ? A ILE 13 14 1 Y 1 A ALA 14 ? A ALA 14 15 1 Y 1 A GLU 106 ? A GLU 106 16 1 Y 1 A ILE 107 ? A ILE 107 17 1 Y 1 A LYS 108 ? A LYS 108 18 1 Y 1 A LYS 109 ? A LYS 109 19 1 Y 1 A ARG 110 ? A ARG 110 20 1 Y 1 A ARG 111 ? A ARG 111 21 1 Y 1 A LYS 112 ? A LYS 112 22 1 Y 1 A GLU 113 ? A GLU 113 23 1 Y 1 A LYS 114 ? A LYS 114 24 1 Y 1 A MET 115 ? A MET 115 25 1 Y 1 A GLU 116 ? A GLU 116 26 1 Y 1 A TYR 117 ? A TYR 117 27 1 Y 1 A GLY 118 ? A GLY 118 28 1 Y 1 A GLY 119 ? A GLY 119 29 1 Y 1 A LEU 120 ? A LEU 120 30 1 Y 1 A VAL 121 ? A VAL 121 31 1 Y 1 A PRO 122 ? A PRO 122 32 1 Y 1 A ARG 123 ? A ARG 123 33 2 Y 1 A MET 1 ? A MET 1 34 2 Y 1 A ALA 2 ? A ALA 2 35 2 Y 1 A LYS 3 ? A LYS 3 36 2 Y 1 A TYR 4 ? A TYR 4 37 2 Y 1 A ASN 5 ? A ASN 5 38 2 Y 1 A GLU 6 ? A GLU 6 39 2 Y 1 A LYS 7 ? A LYS 7 40 2 Y 1 A LYS 8 ? A LYS 8 41 2 Y 1 A GLU 9 ? A GLU 9 42 2 Y 1 A LYS 10 ? A LYS 10 43 2 Y 1 A LYS 11 ? A LYS 11 44 2 Y 1 A ARG 12 ? A ARG 12 45 2 Y 1 A ILE 13 ? A ILE 13 46 2 Y 1 A ALA 14 ? A ALA 14 47 2 Y 1 A GLU 106 ? A GLU 106 48 2 Y 1 A ILE 107 ? A ILE 107 49 2 Y 1 A LYS 108 ? A LYS 108 50 2 Y 1 A LYS 109 ? A LYS 109 51 2 Y 1 A ARG 110 ? A ARG 110 52 2 Y 1 A ARG 111 ? A ARG 111 53 2 Y 1 A LYS 112 ? A LYS 112 54 2 Y 1 A GLU 113 ? A GLU 113 55 2 Y 1 A LYS 114 ? A LYS 114 56 2 Y 1 A MET 115 ? A MET 115 57 2 Y 1 A GLU 116 ? A GLU 116 58 2 Y 1 A TYR 117 ? A TYR 117 59 2 Y 1 A GLY 118 ? A GLY 118 60 2 Y 1 A GLY 119 ? A GLY 119 61 2 Y 1 A LEU 120 ? A LEU 120 62 2 Y 1 A VAL 121 ? A VAL 121 63 2 Y 1 A PRO 122 ? A PRO 122 64 2 Y 1 A ARG 123 ? A ARG 123 65 3 Y 1 A MET 1 ? A MET 1 66 3 Y 1 A ALA 2 ? A ALA 2 67 3 Y 1 A LYS 3 ? A LYS 3 68 3 Y 1 A TYR 4 ? A TYR 4 69 3 Y 1 A ASN 5 ? A ASN 5 70 3 Y 1 A GLU 6 ? A GLU 6 71 3 Y 1 A LYS 7 ? A LYS 7 72 3 Y 1 A LYS 8 ? A LYS 8 73 3 Y 1 A GLU 9 ? A GLU 9 74 3 Y 1 A LYS 10 ? A LYS 10 75 3 Y 1 A LYS 11 ? A LYS 11 76 3 Y 1 A ARG 12 ? A ARG 12 77 3 Y 1 A ILE 13 ? A ILE 13 78 3 Y 1 A ALA 14 ? A ALA 14 79 3 Y 1 A GLU 106 ? A GLU 106 80 3 Y 1 A ILE 107 ? A ILE 107 81 3 Y 1 A LYS 108 ? A LYS 108 82 3 Y 1 A LYS 109 ? A LYS 109 83 3 Y 1 A ARG 110 ? A ARG 110 84 3 Y 1 A ARG 111 ? A ARG 111 85 3 Y 1 A LYS 112 ? A LYS 112 86 3 Y 1 A GLU 113 ? A GLU 113 87 3 Y 1 A LYS 114 ? A LYS 114 88 3 Y 1 A MET 115 ? A MET 115 89 3 Y 1 A GLU 116 ? A GLU 116 90 3 Y 1 A TYR 117 ? A TYR 117 91 3 Y 1 A GLY 118 ? A GLY 118 92 3 Y 1 A GLY 119 ? A GLY 119 93 3 Y 1 A LEU 120 ? A LEU 120 94 3 Y 1 A VAL 121 ? A VAL 121 95 3 Y 1 A PRO 122 ? A PRO 122 96 3 Y 1 A ARG 123 ? A ARG 123 97 4 Y 1 A MET 1 ? A MET 1 98 4 Y 1 A ALA 2 ? A ALA 2 99 4 Y 1 A LYS 3 ? A LYS 3 100 4 Y 1 A TYR 4 ? A TYR 4 101 4 Y 1 A ASN 5 ? A ASN 5 102 4 Y 1 A GLU 6 ? A GLU 6 103 4 Y 1 A LYS 7 ? A LYS 7 104 4 Y 1 A LYS 8 ? A LYS 8 105 4 Y 1 A GLU 9 ? A GLU 9 106 4 Y 1 A LYS 10 ? A LYS 10 107 4 Y 1 A LYS 11 ? A LYS 11 108 4 Y 1 A ARG 12 ? A ARG 12 109 4 Y 1 A ILE 13 ? A ILE 13 110 4 Y 1 A ALA 14 ? A ALA 14 111 4 Y 1 A GLU 106 ? A GLU 106 112 4 Y 1 A ILE 107 ? A ILE 107 113 4 Y 1 A LYS 108 ? A LYS 108 114 4 Y 1 A LYS 109 ? A LYS 109 115 4 Y 1 A ARG 110 ? A ARG 110 116 4 Y 1 A ARG 111 ? A ARG 111 117 4 Y 1 A LYS 112 ? A LYS 112 118 4 Y 1 A GLU 113 ? A GLU 113 119 4 Y 1 A LYS 114 ? A LYS 114 120 4 Y 1 A MET 115 ? A MET 115 121 4 Y 1 A GLU 116 ? A GLU 116 122 4 Y 1 A TYR 117 ? A TYR 117 123 4 Y 1 A GLY 118 ? A GLY 118 124 4 Y 1 A GLY 119 ? A GLY 119 125 4 Y 1 A LEU 120 ? A LEU 120 126 4 Y 1 A VAL 121 ? A VAL 121 127 4 Y 1 A PRO 122 ? A PRO 122 128 4 Y 1 A ARG 123 ? A ARG 123 129 5 Y 1 A MET 1 ? A MET 1 130 5 Y 1 A ALA 2 ? A ALA 2 131 5 Y 1 A LYS 3 ? A LYS 3 132 5 Y 1 A TYR 4 ? A TYR 4 133 5 Y 1 A ASN 5 ? A ASN 5 134 5 Y 1 A GLU 6 ? A GLU 6 135 5 Y 1 A LYS 7 ? A LYS 7 136 5 Y 1 A LYS 8 ? A LYS 8 137 5 Y 1 A GLU 9 ? A GLU 9 138 5 Y 1 A LYS 10 ? A LYS 10 139 5 Y 1 A LYS 11 ? A LYS 11 140 5 Y 1 A ARG 12 ? A ARG 12 141 5 Y 1 A ILE 13 ? A ILE 13 142 5 Y 1 A ALA 14 ? A ALA 14 143 5 Y 1 A GLU 106 ? A GLU 106 144 5 Y 1 A ILE 107 ? A ILE 107 145 5 Y 1 A LYS 108 ? A LYS 108 146 5 Y 1 A LYS 109 ? A LYS 109 147 5 Y 1 A ARG 110 ? A ARG 110 148 5 Y 1 A ARG 111 ? A ARG 111 149 5 Y 1 A LYS 112 ? A LYS 112 150 5 Y 1 A GLU 113 ? A GLU 113 151 5 Y 1 A LYS 114 ? A LYS 114 152 5 Y 1 A MET 115 ? A MET 115 153 5 Y 1 A GLU 116 ? A GLU 116 154 5 Y 1 A TYR 117 ? A TYR 117 155 5 Y 1 A GLY 118 ? A GLY 118 156 5 Y 1 A GLY 119 ? A GLY 119 157 5 Y 1 A LEU 120 ? A LEU 120 158 5 Y 1 A VAL 121 ? A VAL 121 159 5 Y 1 A PRO 122 ? A PRO 122 160 5 Y 1 A ARG 123 ? A ARG 123 161 6 Y 1 A MET 1 ? A MET 1 162 6 Y 1 A ALA 2 ? A ALA 2 163 6 Y 1 A LYS 3 ? A LYS 3 164 6 Y 1 A TYR 4 ? A TYR 4 165 6 Y 1 A ASN 5 ? A ASN 5 166 6 Y 1 A GLU 6 ? A GLU 6 167 6 Y 1 A LYS 7 ? A LYS 7 168 6 Y 1 A LYS 8 ? A LYS 8 169 6 Y 1 A GLU 9 ? A GLU 9 170 6 Y 1 A LYS 10 ? A LYS 10 171 6 Y 1 A LYS 11 ? A LYS 11 172 6 Y 1 A ARG 12 ? A ARG 12 173 6 Y 1 A ILE 13 ? A ILE 13 174 6 Y 1 A ALA 14 ? A ALA 14 175 6 Y 1 A GLU 106 ? A GLU 106 176 6 Y 1 A ILE 107 ? A ILE 107 177 6 Y 1 A LYS 108 ? A LYS 108 178 6 Y 1 A LYS 109 ? A LYS 109 179 6 Y 1 A ARG 110 ? A ARG 110 180 6 Y 1 A ARG 111 ? A ARG 111 181 6 Y 1 A LYS 112 ? A LYS 112 182 6 Y 1 A GLU 113 ? A GLU 113 183 6 Y 1 A LYS 114 ? A LYS 114 184 6 Y 1 A MET 115 ? A MET 115 185 6 Y 1 A GLU 116 ? A GLU 116 186 6 Y 1 A TYR 117 ? A TYR 117 187 6 Y 1 A GLY 118 ? A GLY 118 188 6 Y 1 A GLY 119 ? A GLY 119 189 6 Y 1 A LEU 120 ? A LEU 120 190 6 Y 1 A VAL 121 ? A VAL 121 191 6 Y 1 A PRO 122 ? A PRO 122 192 6 Y 1 A ARG 123 ? A ARG 123 193 7 Y 1 A MET 1 ? A MET 1 194 7 Y 1 A ALA 2 ? A ALA 2 195 7 Y 1 A LYS 3 ? A LYS 3 196 7 Y 1 A TYR 4 ? A TYR 4 197 7 Y 1 A ASN 5 ? A ASN 5 198 7 Y 1 A GLU 6 ? A GLU 6 199 7 Y 1 A LYS 7 ? A LYS 7 200 7 Y 1 A LYS 8 ? A LYS 8 201 7 Y 1 A GLU 9 ? A GLU 9 202 7 Y 1 A LYS 10 ? A LYS 10 203 7 Y 1 A LYS 11 ? A LYS 11 204 7 Y 1 A ARG 12 ? A ARG 12 205 7 Y 1 A ILE 13 ? A ILE 13 206 7 Y 1 A ALA 14 ? A ALA 14 207 7 Y 1 A GLU 106 ? A GLU 106 208 7 Y 1 A ILE 107 ? A ILE 107 209 7 Y 1 A LYS 108 ? A LYS 108 210 7 Y 1 A LYS 109 ? A LYS 109 211 7 Y 1 A ARG 110 ? A ARG 110 212 7 Y 1 A ARG 111 ? A ARG 111 213 7 Y 1 A LYS 112 ? A LYS 112 214 7 Y 1 A GLU 113 ? A GLU 113 215 7 Y 1 A LYS 114 ? A LYS 114 216 7 Y 1 A MET 115 ? A MET 115 217 7 Y 1 A GLU 116 ? A GLU 116 218 7 Y 1 A TYR 117 ? A TYR 117 219 7 Y 1 A GLY 118 ? A GLY 118 220 7 Y 1 A GLY 119 ? A GLY 119 221 7 Y 1 A LEU 120 ? A LEU 120 222 7 Y 1 A VAL 121 ? A VAL 121 223 7 Y 1 A PRO 122 ? A PRO 122 224 7 Y 1 A ARG 123 ? A ARG 123 225 8 Y 1 A MET 1 ? A MET 1 226 8 Y 1 A ALA 2 ? A ALA 2 227 8 Y 1 A LYS 3 ? A LYS 3 228 8 Y 1 A TYR 4 ? A TYR 4 229 8 Y 1 A ASN 5 ? A ASN 5 230 8 Y 1 A GLU 6 ? A GLU 6 231 8 Y 1 A LYS 7 ? A LYS 7 232 8 Y 1 A LYS 8 ? A LYS 8 233 8 Y 1 A GLU 9 ? A GLU 9 234 8 Y 1 A LYS 10 ? A LYS 10 235 8 Y 1 A LYS 11 ? A LYS 11 236 8 Y 1 A ARG 12 ? A ARG 12 237 8 Y 1 A ILE 13 ? A ILE 13 238 8 Y 1 A ALA 14 ? A ALA 14 239 8 Y 1 A GLU 106 ? A GLU 106 240 8 Y 1 A ILE 107 ? A ILE 107 241 8 Y 1 A LYS 108 ? A LYS 108 242 8 Y 1 A LYS 109 ? A LYS 109 243 8 Y 1 A ARG 110 ? A ARG 110 244 8 Y 1 A ARG 111 ? A ARG 111 245 8 Y 1 A LYS 112 ? A LYS 112 246 8 Y 1 A GLU 113 ? A GLU 113 247 8 Y 1 A LYS 114 ? A LYS 114 248 8 Y 1 A MET 115 ? A MET 115 249 8 Y 1 A GLU 116 ? A GLU 116 250 8 Y 1 A TYR 117 ? A TYR 117 251 8 Y 1 A GLY 118 ? A GLY 118 252 8 Y 1 A GLY 119 ? A GLY 119 253 8 Y 1 A LEU 120 ? A LEU 120 254 8 Y 1 A VAL 121 ? A VAL 121 255 8 Y 1 A PRO 122 ? A PRO 122 256 8 Y 1 A ARG 123 ? A ARG 123 257 9 Y 1 A MET 1 ? A MET 1 258 9 Y 1 A ALA 2 ? A ALA 2 259 9 Y 1 A LYS 3 ? A LYS 3 260 9 Y 1 A TYR 4 ? A TYR 4 261 9 Y 1 A ASN 5 ? A ASN 5 262 9 Y 1 A GLU 6 ? A GLU 6 263 9 Y 1 A LYS 7 ? A LYS 7 264 9 Y 1 A LYS 8 ? A LYS 8 265 9 Y 1 A GLU 9 ? A GLU 9 266 9 Y 1 A LYS 10 ? A LYS 10 267 9 Y 1 A LYS 11 ? A LYS 11 268 9 Y 1 A ARG 12 ? A ARG 12 269 9 Y 1 A ILE 13 ? A ILE 13 270 9 Y 1 A ALA 14 ? A ALA 14 271 9 Y 1 A GLU 106 ? A GLU 106 272 9 Y 1 A ILE 107 ? A ILE 107 273 9 Y 1 A LYS 108 ? A LYS 108 274 9 Y 1 A LYS 109 ? A LYS 109 275 9 Y 1 A ARG 110 ? A ARG 110 276 9 Y 1 A ARG 111 ? A ARG 111 277 9 Y 1 A LYS 112 ? A LYS 112 278 9 Y 1 A GLU 113 ? A GLU 113 279 9 Y 1 A LYS 114 ? A LYS 114 280 9 Y 1 A MET 115 ? A MET 115 281 9 Y 1 A GLU 116 ? A GLU 116 282 9 Y 1 A TYR 117 ? A TYR 117 283 9 Y 1 A GLY 118 ? A GLY 118 284 9 Y 1 A GLY 119 ? A GLY 119 285 9 Y 1 A LEU 120 ? A LEU 120 286 9 Y 1 A VAL 121 ? A VAL 121 287 9 Y 1 A PRO 122 ? A PRO 122 288 9 Y 1 A ARG 123 ? A ARG 123 289 10 Y 1 A MET 1 ? A MET 1 290 10 Y 1 A ALA 2 ? A ALA 2 291 10 Y 1 A LYS 3 ? A LYS 3 292 10 Y 1 A TYR 4 ? A TYR 4 293 10 Y 1 A ASN 5 ? A ASN 5 294 10 Y 1 A GLU 6 ? A GLU 6 295 10 Y 1 A LYS 7 ? A LYS 7 296 10 Y 1 A LYS 8 ? A LYS 8 297 10 Y 1 A GLU 9 ? A GLU 9 298 10 Y 1 A LYS 10 ? A LYS 10 299 10 Y 1 A LYS 11 ? A LYS 11 300 10 Y 1 A ARG 12 ? A ARG 12 301 10 Y 1 A ILE 13 ? A ILE 13 302 10 Y 1 A ALA 14 ? A ALA 14 303 10 Y 1 A GLU 106 ? A GLU 106 304 10 Y 1 A ILE 107 ? A ILE 107 305 10 Y 1 A LYS 108 ? A LYS 108 306 10 Y 1 A LYS 109 ? A LYS 109 307 10 Y 1 A ARG 110 ? A ARG 110 308 10 Y 1 A ARG 111 ? A ARG 111 309 10 Y 1 A LYS 112 ? A LYS 112 310 10 Y 1 A GLU 113 ? A GLU 113 311 10 Y 1 A LYS 114 ? A LYS 114 312 10 Y 1 A MET 115 ? A MET 115 313 10 Y 1 A GLU 116 ? A GLU 116 314 10 Y 1 A TYR 117 ? A TYR 117 315 10 Y 1 A GLY 118 ? A GLY 118 316 10 Y 1 A GLY 119 ? A GLY 119 317 10 Y 1 A LEU 120 ? A LEU 120 318 10 Y 1 A VAL 121 ? A VAL 121 319 10 Y 1 A PRO 122 ? A PRO 122 320 10 Y 1 A ARG 123 ? A ARG 123 321 11 Y 1 A MET 1 ? A MET 1 322 11 Y 1 A ALA 2 ? A ALA 2 323 11 Y 1 A LYS 3 ? A LYS 3 324 11 Y 1 A TYR 4 ? A TYR 4 325 11 Y 1 A ASN 5 ? A ASN 5 326 11 Y 1 A GLU 6 ? A GLU 6 327 11 Y 1 A LYS 7 ? A LYS 7 328 11 Y 1 A LYS 8 ? A LYS 8 329 11 Y 1 A GLU 9 ? A GLU 9 330 11 Y 1 A LYS 10 ? A LYS 10 331 11 Y 1 A LYS 11 ? A LYS 11 332 11 Y 1 A ARG 12 ? A ARG 12 333 11 Y 1 A ILE 13 ? A ILE 13 334 11 Y 1 A ALA 14 ? A ALA 14 335 11 Y 1 A GLU 106 ? A GLU 106 336 11 Y 1 A ILE 107 ? A ILE 107 337 11 Y 1 A LYS 108 ? A LYS 108 338 11 Y 1 A LYS 109 ? A LYS 109 339 11 Y 1 A ARG 110 ? A ARG 110 340 11 Y 1 A ARG 111 ? A ARG 111 341 11 Y 1 A LYS 112 ? A LYS 112 342 11 Y 1 A GLU 113 ? A GLU 113 343 11 Y 1 A LYS 114 ? A LYS 114 344 11 Y 1 A MET 115 ? A MET 115 345 11 Y 1 A GLU 116 ? A GLU 116 346 11 Y 1 A TYR 117 ? A TYR 117 347 11 Y 1 A GLY 118 ? A GLY 118 348 11 Y 1 A GLY 119 ? A GLY 119 349 11 Y 1 A LEU 120 ? A LEU 120 350 11 Y 1 A VAL 121 ? A VAL 121 351 11 Y 1 A PRO 122 ? A PRO 122 352 11 Y 1 A ARG 123 ? A ARG 123 353 12 Y 1 A MET 1 ? A MET 1 354 12 Y 1 A ALA 2 ? A ALA 2 355 12 Y 1 A LYS 3 ? A LYS 3 356 12 Y 1 A TYR 4 ? A TYR 4 357 12 Y 1 A ASN 5 ? A ASN 5 358 12 Y 1 A GLU 6 ? A GLU 6 359 12 Y 1 A LYS 7 ? A LYS 7 360 12 Y 1 A LYS 8 ? A LYS 8 361 12 Y 1 A GLU 9 ? A GLU 9 362 12 Y 1 A LYS 10 ? A LYS 10 363 12 Y 1 A LYS 11 ? A LYS 11 364 12 Y 1 A ARG 12 ? A ARG 12 365 12 Y 1 A ILE 13 ? A ILE 13 366 12 Y 1 A ALA 14 ? A ALA 14 367 12 Y 1 A GLU 106 ? A GLU 106 368 12 Y 1 A ILE 107 ? A ILE 107 369 12 Y 1 A LYS 108 ? A LYS 108 370 12 Y 1 A LYS 109 ? A LYS 109 371 12 Y 1 A ARG 110 ? A ARG 110 372 12 Y 1 A ARG 111 ? A ARG 111 373 12 Y 1 A LYS 112 ? A LYS 112 374 12 Y 1 A GLU 113 ? A GLU 113 375 12 Y 1 A LYS 114 ? A LYS 114 376 12 Y 1 A MET 115 ? A MET 115 377 12 Y 1 A GLU 116 ? A GLU 116 378 12 Y 1 A TYR 117 ? A TYR 117 379 12 Y 1 A GLY 118 ? A GLY 118 380 12 Y 1 A GLY 119 ? A GLY 119 381 12 Y 1 A LEU 120 ? A LEU 120 382 12 Y 1 A VAL 121 ? A VAL 121 383 12 Y 1 A PRO 122 ? A PRO 122 384 12 Y 1 A ARG 123 ? A ARG 123 385 13 Y 1 A MET 1 ? A MET 1 386 13 Y 1 A ALA 2 ? A ALA 2 387 13 Y 1 A LYS 3 ? A LYS 3 388 13 Y 1 A TYR 4 ? A TYR 4 389 13 Y 1 A ASN 5 ? A ASN 5 390 13 Y 1 A GLU 6 ? A GLU 6 391 13 Y 1 A LYS 7 ? A LYS 7 392 13 Y 1 A LYS 8 ? A LYS 8 393 13 Y 1 A GLU 9 ? A GLU 9 394 13 Y 1 A LYS 10 ? A LYS 10 395 13 Y 1 A LYS 11 ? A LYS 11 396 13 Y 1 A ARG 12 ? A ARG 12 397 13 Y 1 A ILE 13 ? A ILE 13 398 13 Y 1 A ALA 14 ? A ALA 14 399 13 Y 1 A GLU 106 ? A GLU 106 400 13 Y 1 A ILE 107 ? A ILE 107 401 13 Y 1 A LYS 108 ? A LYS 108 402 13 Y 1 A LYS 109 ? A LYS 109 403 13 Y 1 A ARG 110 ? A ARG 110 404 13 Y 1 A ARG 111 ? A ARG 111 405 13 Y 1 A LYS 112 ? A LYS 112 406 13 Y 1 A GLU 113 ? A GLU 113 407 13 Y 1 A LYS 114 ? A LYS 114 408 13 Y 1 A MET 115 ? A MET 115 409 13 Y 1 A GLU 116 ? A GLU 116 410 13 Y 1 A TYR 117 ? A TYR 117 411 13 Y 1 A GLY 118 ? A GLY 118 412 13 Y 1 A GLY 119 ? A GLY 119 413 13 Y 1 A LEU 120 ? A LEU 120 414 13 Y 1 A VAL 121 ? A VAL 121 415 13 Y 1 A PRO 122 ? A PRO 122 416 13 Y 1 A ARG 123 ? A ARG 123 417 14 Y 1 A MET 1 ? A MET 1 418 14 Y 1 A ALA 2 ? A ALA 2 419 14 Y 1 A LYS 3 ? A LYS 3 420 14 Y 1 A TYR 4 ? A TYR 4 421 14 Y 1 A ASN 5 ? A ASN 5 422 14 Y 1 A GLU 6 ? A GLU 6 423 14 Y 1 A LYS 7 ? A LYS 7 424 14 Y 1 A LYS 8 ? A LYS 8 425 14 Y 1 A GLU 9 ? A GLU 9 426 14 Y 1 A LYS 10 ? A LYS 10 427 14 Y 1 A LYS 11 ? A LYS 11 428 14 Y 1 A ARG 12 ? A ARG 12 429 14 Y 1 A ILE 13 ? A ILE 13 430 14 Y 1 A ALA 14 ? A ALA 14 431 14 Y 1 A GLU 106 ? A GLU 106 432 14 Y 1 A ILE 107 ? A ILE 107 433 14 Y 1 A LYS 108 ? A LYS 108 434 14 Y 1 A LYS 109 ? A LYS 109 435 14 Y 1 A ARG 110 ? A ARG 110 436 14 Y 1 A ARG 111 ? A ARG 111 437 14 Y 1 A LYS 112 ? A LYS 112 438 14 Y 1 A GLU 113 ? A GLU 113 439 14 Y 1 A LYS 114 ? A LYS 114 440 14 Y 1 A MET 115 ? A MET 115 441 14 Y 1 A GLU 116 ? A GLU 116 442 14 Y 1 A TYR 117 ? A TYR 117 443 14 Y 1 A GLY 118 ? A GLY 118 444 14 Y 1 A GLY 119 ? A GLY 119 445 14 Y 1 A LEU 120 ? A LEU 120 446 14 Y 1 A VAL 121 ? A VAL 121 447 14 Y 1 A PRO 122 ? A PRO 122 448 14 Y 1 A ARG 123 ? A ARG 123 449 15 Y 1 A MET 1 ? A MET 1 450 15 Y 1 A ALA 2 ? A ALA 2 451 15 Y 1 A LYS 3 ? A LYS 3 452 15 Y 1 A TYR 4 ? A TYR 4 453 15 Y 1 A ASN 5 ? A ASN 5 454 15 Y 1 A GLU 6 ? A GLU 6 455 15 Y 1 A LYS 7 ? A LYS 7 456 15 Y 1 A LYS 8 ? A LYS 8 457 15 Y 1 A GLU 9 ? A GLU 9 458 15 Y 1 A LYS 10 ? A LYS 10 459 15 Y 1 A LYS 11 ? A LYS 11 460 15 Y 1 A ARG 12 ? A ARG 12 461 15 Y 1 A ILE 13 ? A ILE 13 462 15 Y 1 A ALA 14 ? A ALA 14 463 15 Y 1 A GLU 106 ? A GLU 106 464 15 Y 1 A ILE 107 ? A ILE 107 465 15 Y 1 A LYS 108 ? A LYS 108 466 15 Y 1 A LYS 109 ? A LYS 109 467 15 Y 1 A ARG 110 ? A ARG 110 468 15 Y 1 A ARG 111 ? A ARG 111 469 15 Y 1 A LYS 112 ? A LYS 112 470 15 Y 1 A GLU 113 ? A GLU 113 471 15 Y 1 A LYS 114 ? A LYS 114 472 15 Y 1 A MET 115 ? A MET 115 473 15 Y 1 A GLU 116 ? A GLU 116 474 15 Y 1 A TYR 117 ? A TYR 117 475 15 Y 1 A GLY 118 ? A GLY 118 476 15 Y 1 A GLY 119 ? A GLY 119 477 15 Y 1 A LEU 120 ? A LEU 120 478 15 Y 1 A VAL 121 ? A VAL 121 479 15 Y 1 A PRO 122 ? A PRO 122 480 15 Y 1 A ARG 123 ? A ARG 123 481 16 Y 1 A MET 1 ? A MET 1 482 16 Y 1 A ALA 2 ? A ALA 2 483 16 Y 1 A LYS 3 ? A LYS 3 484 16 Y 1 A TYR 4 ? A TYR 4 485 16 Y 1 A ASN 5 ? A ASN 5 486 16 Y 1 A GLU 6 ? A GLU 6 487 16 Y 1 A LYS 7 ? A LYS 7 488 16 Y 1 A LYS 8 ? A LYS 8 489 16 Y 1 A GLU 9 ? A GLU 9 490 16 Y 1 A LYS 10 ? A LYS 10 491 16 Y 1 A LYS 11 ? A LYS 11 492 16 Y 1 A ARG 12 ? A ARG 12 493 16 Y 1 A ILE 13 ? A ILE 13 494 16 Y 1 A ALA 14 ? A ALA 14 495 16 Y 1 A GLU 106 ? A GLU 106 496 16 Y 1 A ILE 107 ? A ILE 107 497 16 Y 1 A LYS 108 ? A LYS 108 498 16 Y 1 A LYS 109 ? A LYS 109 499 16 Y 1 A ARG 110 ? A ARG 110 500 16 Y 1 A ARG 111 ? A ARG 111 501 16 Y 1 A LYS 112 ? A LYS 112 502 16 Y 1 A GLU 113 ? A GLU 113 503 16 Y 1 A LYS 114 ? A LYS 114 504 16 Y 1 A MET 115 ? A MET 115 505 16 Y 1 A GLU 116 ? A GLU 116 506 16 Y 1 A TYR 117 ? A TYR 117 507 16 Y 1 A GLY 118 ? A GLY 118 508 16 Y 1 A GLY 119 ? A GLY 119 509 16 Y 1 A LEU 120 ? A LEU 120 510 16 Y 1 A VAL 121 ? A VAL 121 511 16 Y 1 A PRO 122 ? A PRO 122 512 16 Y 1 A ARG 123 ? A ARG 123 513 17 Y 1 A MET 1 ? A MET 1 514 17 Y 1 A ALA 2 ? A ALA 2 515 17 Y 1 A LYS 3 ? A LYS 3 516 17 Y 1 A TYR 4 ? A TYR 4 517 17 Y 1 A ASN 5 ? A ASN 5 518 17 Y 1 A GLU 6 ? A GLU 6 519 17 Y 1 A LYS 7 ? A LYS 7 520 17 Y 1 A LYS 8 ? A LYS 8 521 17 Y 1 A GLU 9 ? A GLU 9 522 17 Y 1 A LYS 10 ? A LYS 10 523 17 Y 1 A LYS 11 ? A LYS 11 524 17 Y 1 A ARG 12 ? A ARG 12 525 17 Y 1 A ILE 13 ? A ILE 13 526 17 Y 1 A ALA 14 ? A ALA 14 527 17 Y 1 A GLU 106 ? A GLU 106 528 17 Y 1 A ILE 107 ? A ILE 107 529 17 Y 1 A LYS 108 ? A LYS 108 530 17 Y 1 A LYS 109 ? A LYS 109 531 17 Y 1 A ARG 110 ? A ARG 110 532 17 Y 1 A ARG 111 ? A ARG 111 533 17 Y 1 A LYS 112 ? A LYS 112 534 17 Y 1 A GLU 113 ? A GLU 113 535 17 Y 1 A LYS 114 ? A LYS 114 536 17 Y 1 A MET 115 ? A MET 115 537 17 Y 1 A GLU 116 ? A GLU 116 538 17 Y 1 A TYR 117 ? A TYR 117 539 17 Y 1 A GLY 118 ? A GLY 118 540 17 Y 1 A GLY 119 ? A GLY 119 541 17 Y 1 A LEU 120 ? A LEU 120 542 17 Y 1 A VAL 121 ? A VAL 121 543 17 Y 1 A PRO 122 ? A PRO 122 544 17 Y 1 A ARG 123 ? A ARG 123 545 18 Y 1 A MET 1 ? A MET 1 546 18 Y 1 A ALA 2 ? A ALA 2 547 18 Y 1 A LYS 3 ? A LYS 3 548 18 Y 1 A TYR 4 ? A TYR 4 549 18 Y 1 A ASN 5 ? A ASN 5 550 18 Y 1 A GLU 6 ? A GLU 6 551 18 Y 1 A LYS 7 ? A LYS 7 552 18 Y 1 A LYS 8 ? A LYS 8 553 18 Y 1 A GLU 9 ? A GLU 9 554 18 Y 1 A LYS 10 ? A LYS 10 555 18 Y 1 A LYS 11 ? A LYS 11 556 18 Y 1 A ARG 12 ? A ARG 12 557 18 Y 1 A ILE 13 ? A ILE 13 558 18 Y 1 A ALA 14 ? A ALA 14 559 18 Y 1 A GLU 106 ? A GLU 106 560 18 Y 1 A ILE 107 ? A ILE 107 561 18 Y 1 A LYS 108 ? A LYS 108 562 18 Y 1 A LYS 109 ? A LYS 109 563 18 Y 1 A ARG 110 ? A ARG 110 564 18 Y 1 A ARG 111 ? A ARG 111 565 18 Y 1 A LYS 112 ? A LYS 112 566 18 Y 1 A GLU 113 ? A GLU 113 567 18 Y 1 A LYS 114 ? A LYS 114 568 18 Y 1 A MET 115 ? A MET 115 569 18 Y 1 A GLU 116 ? A GLU 116 570 18 Y 1 A TYR 117 ? A TYR 117 571 18 Y 1 A GLY 118 ? A GLY 118 572 18 Y 1 A GLY 119 ? A GLY 119 573 18 Y 1 A LEU 120 ? A LEU 120 574 18 Y 1 A VAL 121 ? A VAL 121 575 18 Y 1 A PRO 122 ? A PRO 122 576 18 Y 1 A ARG 123 ? A ARG 123 577 19 Y 1 A MET 1 ? A MET 1 578 19 Y 1 A ALA 2 ? A ALA 2 579 19 Y 1 A LYS 3 ? A LYS 3 580 19 Y 1 A TYR 4 ? A TYR 4 581 19 Y 1 A ASN 5 ? A ASN 5 582 19 Y 1 A GLU 6 ? A GLU 6 583 19 Y 1 A LYS 7 ? A LYS 7 584 19 Y 1 A LYS 8 ? A LYS 8 585 19 Y 1 A GLU 9 ? A GLU 9 586 19 Y 1 A LYS 10 ? A LYS 10 587 19 Y 1 A LYS 11 ? A LYS 11 588 19 Y 1 A ARG 12 ? A ARG 12 589 19 Y 1 A ILE 13 ? A ILE 13 590 19 Y 1 A ALA 14 ? A ALA 14 591 19 Y 1 A GLU 106 ? A GLU 106 592 19 Y 1 A ILE 107 ? A ILE 107 593 19 Y 1 A LYS 108 ? A LYS 108 594 19 Y 1 A LYS 109 ? A LYS 109 595 19 Y 1 A ARG 110 ? A ARG 110 596 19 Y 1 A ARG 111 ? A ARG 111 597 19 Y 1 A LYS 112 ? A LYS 112 598 19 Y 1 A GLU 113 ? A GLU 113 599 19 Y 1 A LYS 114 ? A LYS 114 600 19 Y 1 A MET 115 ? A MET 115 601 19 Y 1 A GLU 116 ? A GLU 116 602 19 Y 1 A TYR 117 ? A TYR 117 603 19 Y 1 A GLY 118 ? A GLY 118 604 19 Y 1 A GLY 119 ? A GLY 119 605 19 Y 1 A LEU 120 ? A LEU 120 606 19 Y 1 A VAL 121 ? A VAL 121 607 19 Y 1 A PRO 122 ? A PRO 122 608 19 Y 1 A ARG 123 ? A ARG 123 609 20 Y 1 A MET 1 ? A MET 1 610 20 Y 1 A ALA 2 ? A ALA 2 611 20 Y 1 A LYS 3 ? A LYS 3 612 20 Y 1 A TYR 4 ? A TYR 4 613 20 Y 1 A ASN 5 ? A ASN 5 614 20 Y 1 A GLU 6 ? A GLU 6 615 20 Y 1 A LYS 7 ? A LYS 7 616 20 Y 1 A LYS 8 ? A LYS 8 617 20 Y 1 A GLU 9 ? A GLU 9 618 20 Y 1 A LYS 10 ? A LYS 10 619 20 Y 1 A LYS 11 ? A LYS 11 620 20 Y 1 A ARG 12 ? A ARG 12 621 20 Y 1 A ILE 13 ? A ILE 13 622 20 Y 1 A ALA 14 ? A ALA 14 623 20 Y 1 A GLU 106 ? A GLU 106 624 20 Y 1 A ILE 107 ? A ILE 107 625 20 Y 1 A LYS 108 ? A LYS 108 626 20 Y 1 A LYS 109 ? A LYS 109 627 20 Y 1 A ARG 110 ? A ARG 110 628 20 Y 1 A ARG 111 ? A ARG 111 629 20 Y 1 A LYS 112 ? A LYS 112 630 20 Y 1 A GLU 113 ? A GLU 113 631 20 Y 1 A LYS 114 ? A LYS 114 632 20 Y 1 A MET 115 ? A MET 115 633 20 Y 1 A GLU 116 ? A GLU 116 634 20 Y 1 A TYR 117 ? A TYR 117 635 20 Y 1 A GLY 118 ? A GLY 118 636 20 Y 1 A GLY 119 ? A GLY 119 637 20 Y 1 A LEU 120 ? A LEU 120 638 20 Y 1 A VAL 121 ? A VAL 121 639 20 Y 1 A PRO 122 ? A PRO 122 640 20 Y 1 A ARG 123 ? A ARG 123 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 TRP N N N N 301 TRP CA C N S 302 TRP C C N N 303 TRP O O N N 304 TRP CB C N N 305 TRP CG C Y N 306 TRP CD1 C Y N 307 TRP CD2 C Y N 308 TRP NE1 N Y N 309 TRP CE2 C Y N 310 TRP CE3 C Y N 311 TRP CZ2 C Y N 312 TRP CZ3 C Y N 313 TRP CH2 C Y N 314 TRP OXT O N N 315 TRP H H N N 316 TRP H2 H N N 317 TRP HA H N N 318 TRP HB2 H N N 319 TRP HB3 H N N 320 TRP HD1 H N N 321 TRP HE1 H N N 322 TRP HE3 H N N 323 TRP HZ2 H N N 324 TRP HZ3 H N N 325 TRP HH2 H N N 326 TRP HXT H N N 327 TYR N N N N 328 TYR CA C N S 329 TYR C C N N 330 TYR O O N N 331 TYR CB C N N 332 TYR CG C Y N 333 TYR CD1 C Y N 334 TYR CD2 C Y N 335 TYR CE1 C Y N 336 TYR CE2 C Y N 337 TYR CZ C Y N 338 TYR OH O N N 339 TYR OXT O N N 340 TYR H H N N 341 TYR H2 H N N 342 TYR HA H N N 343 TYR HB2 H N N 344 TYR HB3 H N N 345 TYR HD1 H N N 346 TYR HD2 H N N 347 TYR HE1 H N N 348 TYR HE2 H N N 349 TYR HH H N N 350 TYR HXT H N N 351 VAL N N N N 352 VAL CA C N S 353 VAL C C N N 354 VAL O O N N 355 VAL CB C N N 356 VAL CG1 C N N 357 VAL CG2 C N N 358 VAL OXT O N N 359 VAL H H N N 360 VAL H2 H N N 361 VAL HA H N N 362 VAL HB H N N 363 VAL HG11 H N N 364 VAL HG12 H N N 365 VAL HG13 H N N 366 VAL HG21 H N N 367 VAL HG22 H N N 368 VAL HG23 H N N 369 VAL HXT H N N 370 ZN ZN ZN N N 371 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 TRP N CA sing N N 288 TRP N H sing N N 289 TRP N H2 sing N N 290 TRP CA C sing N N 291 TRP CA CB sing N N 292 TRP CA HA sing N N 293 TRP C O doub N N 294 TRP C OXT sing N N 295 TRP CB CG sing N N 296 TRP CB HB2 sing N N 297 TRP CB HB3 sing N N 298 TRP CG CD1 doub Y N 299 TRP CG CD2 sing Y N 300 TRP CD1 NE1 sing Y N 301 TRP CD1 HD1 sing N N 302 TRP CD2 CE2 doub Y N 303 TRP CD2 CE3 sing Y N 304 TRP NE1 CE2 sing Y N 305 TRP NE1 HE1 sing N N 306 TRP CE2 CZ2 sing Y N 307 TRP CE3 CZ3 doub Y N 308 TRP CE3 HE3 sing N N 309 TRP CZ2 CH2 doub Y N 310 TRP CZ2 HZ2 sing N N 311 TRP CZ3 CH2 sing Y N 312 TRP CZ3 HZ3 sing N N 313 TRP CH2 HH2 sing N N 314 TRP OXT HXT sing N N 315 TYR N CA sing N N 316 TYR N H sing N N 317 TYR N H2 sing N N 318 TYR CA C sing N N 319 TYR CA CB sing N N 320 TYR CA HA sing N N 321 TYR C O doub N N 322 TYR C OXT sing N N 323 TYR CB CG sing N N 324 TYR CB HB2 sing N N 325 TYR CB HB3 sing N N 326 TYR CG CD1 doub Y N 327 TYR CG CD2 sing Y N 328 TYR CD1 CE1 sing Y N 329 TYR CD1 HD1 sing N N 330 TYR CD2 CE2 doub Y N 331 TYR CD2 HD2 sing N N 332 TYR CE1 CZ doub Y N 333 TYR CE1 HE1 sing N N 334 TYR CE2 CZ sing Y N 335 TYR CE2 HE2 sing N N 336 TYR CZ OH sing N N 337 TYR OH HH sing N N 338 TYR OXT HXT sing N N 339 VAL N CA sing N N 340 VAL N H sing N N 341 VAL N H2 sing N N 342 VAL CA C sing N N 343 VAL CA CB sing N N 344 VAL CA HA sing N N 345 VAL C O doub N N 346 VAL C OXT sing N N 347 VAL CB CG1 sing N N 348 VAL CB CG2 sing N N 349 VAL CB HB sing N N 350 VAL CG1 HG11 sing N N 351 VAL CG1 HG12 sing N N 352 VAL CG1 HG13 sing N N 353 VAL CG2 HG21 sing N N 354 VAL CG2 HG22 sing N N 355 VAL CG2 HG23 sing N N 356 VAL OXT HXT sing N N 357 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker DRX 1 'Bruker DRX' 600 Bruker DMX 2 'Bruker DMX' # _atom_sites.entry_id 2K3R _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_