data_2K49 # _entry.id 2K49 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K49 pdb_00002k49 10.2210/pdb2k49/pdb RCSB RCSB100656 ? ? WWPDB D_1000100656 ? ? BMRB 15791 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details TargetDB SoR190 unspecified . BMRB 15791 unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K49 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-05-31 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tang, Y.' 1 'Wang, D.' 2 'Nwosu, C.' 3 'Maglaqui, M.' 4 'Xiao, R.' 5 'Liu, J.' 6 'Baran, M.C.' 7 'Swapna, G.V.T.' 8 'Acton, T.B.' 9 'Rost, B.' 10 'Montelione, G.T.' 11 'Northeast Structural Genomics Consortium (NESG)' 12 # _citation.id primary _citation.title 'Solution NMR structure of UPF0339 protein SO3888 from Shewanella oneidensis.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tang, Y.' 1 ? primary 'Wang, D.' 2 ? primary 'Nwosu, C.' 3 ? primary 'Maglaqui, M.' 4 ? primary 'Xiao, R.' 5 ? primary 'Liu, J.' 6 ? primary 'Baran, M.C.' 7 ? primary 'Swapna, G.V.T.' 8 ? primary 'Acton, T.B.' 9 ? primary 'Rost, B.' 10 ? primary 'Montelione, G.T.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'UPF0339 protein SO_3888' _entity.formula_weight 13103.619 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSGWYELSKSSNDQFKFVLKAGNGEVILTSELYTGKSGAMNGIESVQTNSPIEARYAKEVAKNDKPYFNLKAANHQIIGT SQMYSSTAARDNGIKSVMENGKTTTIKDLTLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSGWYELSKSSNDQFKFVLKAGNGEVILTSELYTGKSGAMNGIESVQTNSPIEARYAKEVAKNDKPYFNLKAANHQIIGT SQMYSSTAARDNGIKSVMENGKTTTIKDLTLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SoR190 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLY n 1 4 TRP n 1 5 TYR n 1 6 GLU n 1 7 LEU n 1 8 SER n 1 9 LYS n 1 10 SER n 1 11 SER n 1 12 ASN n 1 13 ASP n 1 14 GLN n 1 15 PHE n 1 16 LYS n 1 17 PHE n 1 18 VAL n 1 19 LEU n 1 20 LYS n 1 21 ALA n 1 22 GLY n 1 23 ASN n 1 24 GLY n 1 25 GLU n 1 26 VAL n 1 27 ILE n 1 28 LEU n 1 29 THR n 1 30 SER n 1 31 GLU n 1 32 LEU n 1 33 TYR n 1 34 THR n 1 35 GLY n 1 36 LYS n 1 37 SER n 1 38 GLY n 1 39 ALA n 1 40 MET n 1 41 ASN n 1 42 GLY n 1 43 ILE n 1 44 GLU n 1 45 SER n 1 46 VAL n 1 47 GLN n 1 48 THR n 1 49 ASN n 1 50 SER n 1 51 PRO n 1 52 ILE n 1 53 GLU n 1 54 ALA n 1 55 ARG n 1 56 TYR n 1 57 ALA n 1 58 LYS n 1 59 GLU n 1 60 VAL n 1 61 ALA n 1 62 LYS n 1 63 ASN n 1 64 ASP n 1 65 LYS n 1 66 PRO n 1 67 TYR n 1 68 PHE n 1 69 ASN n 1 70 LEU n 1 71 LYS n 1 72 ALA n 1 73 ALA n 1 74 ASN n 1 75 HIS n 1 76 GLN n 1 77 ILE n 1 78 ILE n 1 79 GLY n 1 80 THR n 1 81 SER n 1 82 GLN n 1 83 MET n 1 84 TYR n 1 85 SER n 1 86 SER n 1 87 THR n 1 88 ALA n 1 89 ALA n 1 90 ARG n 1 91 ASP n 1 92 ASN n 1 93 GLY n 1 94 ILE n 1 95 LYS n 1 96 SER n 1 97 VAL n 1 98 MET n 1 99 GLU n 1 100 ASN n 1 101 GLY n 1 102 LYS n 1 103 THR n 1 104 THR n 1 105 THR n 1 106 ILE n 1 107 LYS n 1 108 ASP n 1 109 LEU n 1 110 THR n 1 111 LEU n 1 112 GLU n 1 113 HIS n 1 114 HIS n 1 115 HIS n 1 116 HIS n 1 117 HIS n 1 118 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SO_3888 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain MR-1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Shewanella oneidensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 211586 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name SoR190-21.2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y3888_SHEON _struct_ref.pdbx_db_accession Q8EAL4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSGWYELSKSSNDQFKFVLKAGNGEVILTSELYTGKSGAMNGIESVQTNSPIEARYAKEVAKNDKPYFNLKAANHQIIGT SQMYSSTAARDNGIKSVMENGKTTTIKDLT ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K49 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 110 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8EAL4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 110 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 110 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K49 LEU A 111 ? UNP Q8EAL4 ? ? 'expression tag' 111 1 1 2K49 GLU A 112 ? UNP Q8EAL4 ? ? 'expression tag' 112 2 1 2K49 HIS A 113 ? UNP Q8EAL4 ? ? 'expression tag' 113 3 1 2K49 HIS A 114 ? UNP Q8EAL4 ? ? 'expression tag' 114 4 1 2K49 HIS A 115 ? UNP Q8EAL4 ? ? 'expression tag' 115 5 1 2K49 HIS A 116 ? UNP Q8EAL4 ? ? 'expression tag' 116 6 1 2K49 HIS A 117 ? UNP Q8EAL4 ? ? 'expression tag' 117 7 1 2K49 HIS A 118 ? UNP Q8EAL4 ? ? 'expression tag' 118 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D 1H-15N NOESY' 1 4 1 '3D simutaneous NOESY' 1 5 1 '3D 1H-13C NOESY aromatic' 1 6 1 '3D HNCO' 1 7 1 '3D HNCACB' 1 8 1 '3D CBCA(CO)NH' 1 9 1 '3D HCCH-COSY' 1 10 1 '3D HCCH-TOCSY' 1 11 1 '3D HBHA(CO)NH' 1 12 2 '2D 1H-13C HSQC_high resolution' 1 13 1 '3D CCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength '0.1 M' _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1.3 mM [U-100% 13C; U-100% 15N] SoR190, 5 mM CaCl2, 100 mM sodium chloride, 20 mM ammonium acetate, 10 mM DTT, 0.02 % NaN3, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;1.3 mM [U-5% 13C; U-100% 15N] SoR190, 5 mM CaCl2, 100 mM sodium chloride, 20 mM ammonium acetate, 10 mM DTT, 0.02 % NaN3, 95% H2O/5% D2O ; 2 '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2K49 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;THE STRUCTURES ARE BASED ON A TOTAL OF 2291 COMFORMATIONALLY-RESTRICTING NOE-DERIVED DISTANCE CONSTRAINTS, 146 DIHEDRAL ANGLE CONSTRAINTS, AND 92 HYDROGEN BOND CONSTRAINTS (22.4 CONSTRAINTS PER RESIDUE, 7.7 LONG RANGE CONSTRAINTS PER RESIDUE, COMPUTED FOR RESIDUES 1 TO 118 BY PSVS 1.3) STRUCTURE DETERMINATION WAS PERFORMED ITERATIVELY USING AUTOSTRUCTURE AND CYANA. THE 20 LOWEST ENERGY STRUCTURES OUT OF 100 WERE FURTHER REFINED BY RESTRAINED MOLECULAR DYNAMICS/ENERGY MINIMIZATION IN EXPLICIT WATER (CNS). THE C-TERMINAL HIS TAG RESIDUES OF THE PROTEIN (HHHHHH) WERE INCLUDED IN ALL STRUCTURE CALCULATIONS AND HAVE BEEN INCLUDED IN THIS DEPOSITION. COORDINATES FOR THE FOLLOWING RESIDUES ARE NOT WELL DETERMINED (S(PHI)+S(PSI)<1.8): 1-3, 21-22, 112-118. THE STRUCTURE WAS DETERMINED USING TRIPLE RESONANCE NMR SPECTROSCOPY. AUTOMATED BACKBONE ASSIGNMENTS WERE MADE USING AUTOASSIGN AND THE SIDE CHAIN ASSIGNMENTS WERE COMPLETED MANUALLY. AUTOMATIC NOESY ASSIGNMENTS AS WELL AS DISTANCE, DIHEDRAL ANGLE (TALOS) AND HYDROGEN BOND CONSTRAINTS WERE DETERMINED USING CYANA. COMPLETENESS OF NMR ASSIGNMENT: BACKBONE, 94.10%, SIDE CHAIN, 82.27%, AROMATICS, 76.92%, STEREOSPECIFIC METHYL, 91.67%, FINAL STRUCTURE QUALITY FACTORS (FOR RESIDUE 1-118 PSVS 1.3), WHERE ORDERED RESIDUE RANGES (S(PHI)+S(PSI)>1.8) COMPRISE: 4-20, 23-111. (A) RMSD (ORDERED RESIDUES): BB 0.6, HEAVY ATOM: 1.1 (B) RAMACHANDRAN STATISTICS FOR ORDERED RESIDUES: MOST FAVORED, 88.1%, ADDITIONALLY ALLOWED: 11.8%, GENEROUSLY ALLOWED : 0.1%, DISALLOWED, 0.0%. (C) PROCHECK SCORES FOR ORDERED RESIDUES (RAW/Z): PHI-PSI, -0.30/-0.87, ALL , -0.12/-0.71. (D) MOLPROBITY CLASH SCORE (RAW/Z): 13.32/-0.76. (E) RPF SCORES FOR GOODNESS OF FIT TO NOESY DATA (RESIDUE 1-118): RECALL, 1, PRECISION, 0.975, F-MEASURE, 0.987, DP-SCORE, 0.89. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2K49 _pdbx_nmr_details.text 'The protein is a monomer by gel filtration chromatography and static light scattering.' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K49 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.22 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K49 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 2.1 1 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.2.1 2 Goddard 'peak picking' Sparky 3.110 3 Goddard 'data analysis' Sparky 3.110 4 'Huang, Tejero, Powers and Montelione' 'structure solution' AutoStructure 2.2.1 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2.3 6 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 7 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.1 8 'Bhattacharya and Montelione' 'data analysis' PSVS 1.3 9 'Tejero and Montelione' pdbanalysis PdbStat 5.0 10 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K49 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K49 _struct.title 'Solution NMR structure of UPF0339 protein SO3888 from Shewanella oneidensis. Northeast Structural Genomics Consortium target SoR190' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K49 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;solution NMR structure, STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 35 ? SER A 50 ? GLY A 35 SER A 50 1 ? 16 HELX_P HELX_P2 2 ILE A 52 ? ALA A 54 ? ILE A 52 ALA A 54 5 ? 3 HELX_P HELX_P3 3 SER A 86 ? GLY A 101 ? SER A 86 GLY A 101 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 26 ? THR A 29 ? VAL A 26 THR A 29 A 2 PHE A 15 ? LYS A 20 ? PHE A 15 LYS A 20 A 3 TRP A 4 ? LYS A 9 ? TRP A 4 LYS A 9 A 4 ILE A 106 ? ASP A 108 ? ILE A 106 ASP A 108 B 1 TYR A 56 ? ALA A 61 ? TYR A 56 ALA A 61 B 2 LYS A 65 ? LYS A 71 ? LYS A 65 LYS A 71 B 3 ILE A 77 ? THR A 80 ? ILE A 77 THR A 80 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 27 ? O ILE A 27 N LEU A 19 ? N LEU A 19 A 2 3 O LYS A 16 ? O LYS A 16 N SER A 8 ? N SER A 8 A 3 4 N LEU A 7 ? N LEU A 7 O LYS A 107 ? O LYS A 107 B 1 2 N ALA A 57 ? N ALA A 57 O ASN A 69 ? O ASN A 69 B 2 3 N LEU A 70 ? N LEU A 70 O GLY A 79 ? O GLY A 79 # _atom_sites.entry_id 2K49 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 HIS 118 118 118 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-07-08 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Source and taxonomy' 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.01 _pdbx_nmr_ensemble_rms.distance_rms_dev_error ? _pdbx_nmr_ensemble_rms.entry_id 2K49 _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id SoR190 1.3 mM '[U-100% 13C; U-100% 15N]' 1 CaCl2 5 mM ? 1 'sodium chloride' 100 mM ? 1 'ammonium acetate' 20 mM ? 1 DTT 10 mM ? 1 NaN3 0.02 % ? 1 SoR190 1.3 mM '[U-5% 13C; U-100% 15N]' 2 CaCl2 5 mM ? 2 'sodium chloride' 100 mM ? 2 'ammonium acetate' 20 mM ? 2 DTT 10 mM ? 2 NaN3 0.02 % ? 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 13 ? ? 70.60 -2.90 2 1 ALA A 54 ? ? -56.41 -9.39 3 1 HIS A 114 ? ? -115.09 67.14 4 2 SER A 2 ? ? -135.21 -48.04 5 2 GLU A 25 ? ? -57.40 107.31 6 2 ALA A 57 ? ? -167.35 101.34 7 2 HIS A 117 ? ? -69.62 99.23 8 3 GLU A 31 ? ? -79.26 -168.71 9 3 MET A 83 ? ? -66.74 99.20 10 3 HIS A 115 ? ? -102.98 -68.73 11 4 ASP A 64 ? ? 63.49 70.33 12 4 HIS A 75 ? ? 65.65 64.37 13 4 HIS A 114 ? ? 62.34 141.88 14 5 LYS A 102 ? ? -76.77 43.60 15 5 HIS A 113 ? ? -68.32 71.14 16 5 HIS A 114 ? ? -50.09 100.11 17 6 LYS A 102 ? ? -77.96 42.76 18 7 ALA A 21 ? ? -79.27 36.27 19 7 ALA A 57 ? ? -164.24 101.40 20 7 LYS A 102 ? ? -98.52 35.70 21 7 HIS A 116 ? ? 67.76 -71.07 22 8 HIS A 75 ? ? 72.71 34.68 23 8 ILE A 77 ? ? -69.07 96.00 24 8 HIS A 113 ? ? -83.45 31.02 25 8 HIS A 114 ? ? -86.33 37.78 26 8 HIS A 116 ? ? -89.54 39.86 27 9 GLU A 31 ? ? -103.47 -167.92 28 9 GLU A 112 ? ? -111.36 -163.40 29 9 HIS A 113 ? ? -146.85 11.88 30 10 ASP A 13 ? ? 74.45 -21.64 31 10 ALA A 57 ? ? -166.55 99.99 32 11 LEU A 111 ? ? -56.71 -73.09 33 11 HIS A 113 ? ? -67.20 87.18 34 12 ASN A 12 ? ? -79.70 26.06 35 12 ASP A 13 ? ? 67.35 -1.01 36 12 ASP A 64 ? ? 64.07 65.71 37 13 ALA A 57 ? ? -160.57 101.09 38 13 ASN A 63 ? ? -69.37 0.91 39 13 THR A 105 ? ? -69.97 93.52 40 14 ALA A 21 ? ? -78.05 26.06 41 14 HIS A 114 ? ? 60.94 102.10 42 14 HIS A 115 ? ? -164.02 103.03 43 14 HIS A 116 ? ? -59.46 102.54 44 15 SER A 2 ? ? -172.47 -172.84 45 15 SER A 30 ? ? -108.27 -167.58 46 15 ALA A 54 ? ? -49.92 -15.34 47 15 LYS A 102 ? ? -78.78 40.85 48 15 HIS A 113 ? ? -170.34 90.54 49 16 GLU A 31 ? ? -119.34 -162.26 50 16 ALA A 54 ? ? -66.81 10.60 51 17 GLU A 31 ? ? -77.14 -167.94 52 17 ASN A 63 ? ? -72.52 26.86 53 17 THR A 105 ? ? -69.20 98.72 54 17 HIS A 115 ? ? 61.36 67.98 55 18 ALA A 57 ? ? -69.52 98.98 56 18 MET A 83 ? ? -56.87 103.91 57 19 SER A 85 ? ? -144.68 -28.92 58 19 THR A 105 ? ? -66.01 90.18 59 19 HIS A 113 ? ? 57.49 17.22 60 19 HIS A 114 ? ? -85.24 30.11 61 20 ALA A 21 ? ? -76.90 39.05 62 20 ALA A 57 ? ? -166.33 107.84 63 20 LYS A 62 ? ? -49.95 -14.85 64 20 SER A 85 ? ? -134.87 -36.84 #