data_2K5O # _entry.id 2K5O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K5O pdb_00002k5o 10.2210/pdb2k5o/pdb RCSB RCSB100707 ? ? BMRB 15845 ? ? WWPDB D_1000100707 ? ? # _pdbx_database_related.db_id 15845 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K5O _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-06-30 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Perez, D.R.' 1 'Wuthrich, K.' 2 # _citation.id primary _citation.title 'NMR Structure of the Bank Vole Prion Protein at 20 degrees C Contains a Structured Loop of Residues 165-171' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 383 _citation.page_first 306 _citation.page_last 312 _citation.year 2008 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18773909 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2008.08.045 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Christen, B.' 1 ? primary 'Perez, D.R.' 2 ? primary 'Hornemann, S.' 3 ? primary 'Wuthrich, K.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Major prion protein' _entity.formula_weight 13435.902 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PrP, PrP27-30, PrP33-35C, CD230 antigen' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYNNQNNFVHDCVNITIKQHTVTTTTKGENF TETDVKMMERVVEQMCVTQYQKESQAYYDGRRSS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYNNQNNFVHDCVNITIKQHTVTTTTKGENF TETDVKMMERVVEQMCVTQYQKESQAYYDGRRSS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 VAL n 1 4 VAL n 1 5 GLY n 1 6 GLY n 1 7 LEU n 1 8 GLY n 1 9 GLY n 1 10 TYR n 1 11 MET n 1 12 LEU n 1 13 GLY n 1 14 SER n 1 15 ALA n 1 16 MET n 1 17 SER n 1 18 ARG n 1 19 PRO n 1 20 MET n 1 21 ILE n 1 22 HIS n 1 23 PHE n 1 24 GLY n 1 25 ASN n 1 26 ASP n 1 27 TRP n 1 28 GLU n 1 29 ASP n 1 30 ARG n 1 31 TYR n 1 32 TYR n 1 33 ARG n 1 34 GLU n 1 35 ASN n 1 36 MET n 1 37 TYR n 1 38 ARG n 1 39 TYR n 1 40 PRO n 1 41 ASN n 1 42 GLN n 1 43 VAL n 1 44 TYR n 1 45 TYR n 1 46 ARG n 1 47 PRO n 1 48 VAL n 1 49 ASP n 1 50 GLN n 1 51 TYR n 1 52 ASN n 1 53 ASN n 1 54 GLN n 1 55 ASN n 1 56 ASN n 1 57 PHE n 1 58 VAL n 1 59 HIS n 1 60 ASP n 1 61 CYS n 1 62 VAL n 1 63 ASN n 1 64 ILE n 1 65 THR n 1 66 ILE n 1 67 LYS n 1 68 GLN n 1 69 HIS n 1 70 THR n 1 71 VAL n 1 72 THR n 1 73 THR n 1 74 THR n 1 75 THR n 1 76 LYS n 1 77 GLY n 1 78 GLU n 1 79 ASN n 1 80 PHE n 1 81 THR n 1 82 GLU n 1 83 THR n 1 84 ASP n 1 85 VAL n 1 86 LYS n 1 87 MET n 1 88 MET n 1 89 GLU n 1 90 ARG n 1 91 VAL n 1 92 VAL n 1 93 GLU n 1 94 GLN n 1 95 MET n 1 96 CYS n 1 97 VAL n 1 98 THR n 1 99 GLN n 1 100 TYR n 1 101 GLN n 1 102 LYS n 1 103 GLU n 1 104 SER n 1 105 GLN n 1 106 ALA n 1 107 TYR n 1 108 TYR n 1 109 ASP n 1 110 GLY n 1 111 ARG n 1 112 ARG n 1 113 SER n 1 114 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Prnp, Prn-p, Prp' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pRSETA _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PRIO_MOUSE _struct_ref.pdbx_db_accession P04925 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTE TDVKMMERVVEQMCVTQYQKESQAYYDGRRSS ; _struct_ref.pdbx_align_begin 120 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K5O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04925 _struct_ref_seq.db_align_beg 120 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 231 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 121 _struct_ref_seq.pdbx_auth_seq_align_end 232 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K5O GLY A 1 ? UNP P04925 ? ? 'expression tag' 119 1 1 2K5O SER A 2 ? UNP P04925 ? ? 'expression tag' 120 2 1 2K5O ASN A 52 ? UNP P04925 SER 169 'engineered mutation' 170 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.01 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298.2 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.4mM [U-99% 13C; U-99% 15N] Prion Protein, 10% D2O, 90% H2O, 10mM [U-2H] sodium acetate, 0.02% sodium azide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 750 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2K5O _pdbx_nmr_refine.method 'OPAL (water shell)' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K5O _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K5O _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection XwinNMR ? 1 'Keller, Rochus' 'data analysis' CARA ? 2 'Herrmann, Guntert and Wuthrich' 'peak picking' ATNOS/CANDID 1.2 3 'Herrmann, Guntert and Wuthrich' 'chemical shift assignment' ATNOS/CANDID 1.2 4 'Guntert, Braun and Wuthrich' 'structure solution' DYANA 1.0.3 5 'Luginbuhl, Guntert, Billeter and Wuthrich' refinement OPAL 1.2 6 'Koradi, Billeter and Wuthrich' 'data analysis' MOLMOL 2K.2 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K5O _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K5O _struct.title 'Mouse Prion Protein (121-231) with Mutation S170N' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K5O _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text ;mouse prion protein, mutation, S170N, bank vole, Membrane, Prion, Glycoprotein, Golgi apparatus, GPI-anchor, Hydroxylation, Lipoprotein, Polymorphism, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 25 ? MET A 36 ? ASN A 143 MET A 154 1 ? 12 HELX_P HELX_P2 2 TYR A 37 ? TYR A 39 ? TYR A 155 TYR A 157 5 ? 3 HELX_P HELX_P3 3 PRO A 47 ? TYR A 51 ? PRO A 165 TYR A 169 5 ? 5 HELX_P HELX_P4 4 ASN A 53 ? THR A 72 ? ASN A 171 THR A 190 1 ? 20 HELX_P HELX_P5 5 THR A 81 ? ASP A 109 ? THR A 199 ASP A 227 1 ? 29 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 61 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 96 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 179 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 214 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.048 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 11 ? LEU A 12 ? MET A 129 LEU A 130 A 2 TYR A 44 ? TYR A 45 ? TYR A 162 TYR A 163 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id MET _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 11 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id MET _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 129 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 45 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 163 # _atom_sites.entry_id 2K5O _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 119 ? ? ? A . n A 1 2 SER 2 120 120 SER SER A . n A 1 3 VAL 3 121 121 VAL VAL A . n A 1 4 VAL 4 122 122 VAL VAL A . n A 1 5 GLY 5 123 123 GLY GLY A . n A 1 6 GLY 6 124 124 GLY GLY A . n A 1 7 LEU 7 125 125 LEU LEU A . n A 1 8 GLY 8 126 126 GLY GLY A . n A 1 9 GLY 9 127 127 GLY GLY A . n A 1 10 TYR 10 128 128 TYR TYR A . n A 1 11 MET 11 129 129 MET MET A . n A 1 12 LEU 12 130 130 LEU LEU A . n A 1 13 GLY 13 131 131 GLY GLY A . n A 1 14 SER 14 132 132 SER SER A . n A 1 15 ALA 15 133 133 ALA ALA A . n A 1 16 MET 16 134 134 MET MET A . n A 1 17 SER 17 135 135 SER SER A . n A 1 18 ARG 18 136 136 ARG ARG A . n A 1 19 PRO 19 137 137 PRO PRO A . n A 1 20 MET 20 138 138 MET MET A . n A 1 21 ILE 21 139 139 ILE ILE A . n A 1 22 HIS 22 140 140 HIS HIS A . n A 1 23 PHE 23 141 141 PHE PHE A . n A 1 24 GLY 24 142 142 GLY GLY A . n A 1 25 ASN 25 143 143 ASN ASN A . n A 1 26 ASP 26 144 144 ASP ASP A . n A 1 27 TRP 27 145 145 TRP TRP A . n A 1 28 GLU 28 146 146 GLU GLU A . n A 1 29 ASP 29 147 147 ASP ASP A . n A 1 30 ARG 30 148 148 ARG ARG A . n A 1 31 TYR 31 149 149 TYR TYR A . n A 1 32 TYR 32 150 150 TYR TYR A . n A 1 33 ARG 33 151 151 ARG ARG A . n A 1 34 GLU 34 152 152 GLU GLU A . n A 1 35 ASN 35 153 153 ASN ASN A . n A 1 36 MET 36 154 154 MET MET A . n A 1 37 TYR 37 155 155 TYR TYR A . n A 1 38 ARG 38 156 156 ARG ARG A . n A 1 39 TYR 39 157 157 TYR TYR A . n A 1 40 PRO 40 158 158 PRO PRO A . n A 1 41 ASN 41 159 159 ASN ASN A . n A 1 42 GLN 42 160 160 GLN GLN A . n A 1 43 VAL 43 161 161 VAL VAL A . n A 1 44 TYR 44 162 162 TYR TYR A . n A 1 45 TYR 45 163 163 TYR TYR A . n A 1 46 ARG 46 164 164 ARG ARG A . n A 1 47 PRO 47 165 165 PRO PRO A . n A 1 48 VAL 48 166 166 VAL VAL A . n A 1 49 ASP 49 167 167 ASP ASP A . n A 1 50 GLN 50 168 168 GLN GLN A . n A 1 51 TYR 51 169 169 TYR TYR A . n A 1 52 ASN 52 170 170 ASN ASN A . n A 1 53 ASN 53 171 171 ASN ASN A . n A 1 54 GLN 54 172 172 GLN GLN A . n A 1 55 ASN 55 173 173 ASN ASN A . n A 1 56 ASN 56 174 174 ASN ASN A . n A 1 57 PHE 57 175 175 PHE PHE A . n A 1 58 VAL 58 176 176 VAL VAL A . n A 1 59 HIS 59 177 177 HIS HIS A . n A 1 60 ASP 60 178 178 ASP ASP A . n A 1 61 CYS 61 179 179 CYS CYS A . n A 1 62 VAL 62 180 180 VAL VAL A . n A 1 63 ASN 63 181 181 ASN ASN A . n A 1 64 ILE 64 182 182 ILE ILE A . n A 1 65 THR 65 183 183 THR THR A . n A 1 66 ILE 66 184 184 ILE ILE A . n A 1 67 LYS 67 185 185 LYS LYS A . n A 1 68 GLN 68 186 186 GLN GLN A . n A 1 69 HIS 69 187 187 HIS HIS A . n A 1 70 THR 70 188 188 THR THR A . n A 1 71 VAL 71 189 189 VAL VAL A . n A 1 72 THR 72 190 190 THR THR A . n A 1 73 THR 73 191 191 THR THR A . n A 1 74 THR 74 192 192 THR THR A . n A 1 75 THR 75 193 193 THR THR A . n A 1 76 LYS 76 194 194 LYS LYS A . n A 1 77 GLY 77 195 195 GLY GLY A . n A 1 78 GLU 78 196 196 GLU GLU A . n A 1 79 ASN 79 197 197 ASN ASN A . n A 1 80 PHE 80 198 198 PHE PHE A . n A 1 81 THR 81 199 199 THR THR A . n A 1 82 GLU 82 200 200 GLU GLU A . n A 1 83 THR 83 201 201 THR THR A . n A 1 84 ASP 84 202 202 ASP ASP A . n A 1 85 VAL 85 203 203 VAL VAL A . n A 1 86 LYS 86 204 204 LYS LYS A . n A 1 87 MET 87 205 205 MET MET A . n A 1 88 MET 88 206 206 MET MET A . n A 1 89 GLU 89 207 207 GLU GLU A . n A 1 90 ARG 90 208 208 ARG ARG A . n A 1 91 VAL 91 209 209 VAL VAL A . n A 1 92 VAL 92 210 210 VAL VAL A . n A 1 93 GLU 93 211 211 GLU GLU A . n A 1 94 GLN 94 212 212 GLN GLN A . n A 1 95 MET 95 213 213 MET MET A . n A 1 96 CYS 96 214 214 CYS CYS A . n A 1 97 VAL 97 215 215 VAL VAL A . n A 1 98 THR 98 216 216 THR THR A . n A 1 99 GLN 99 217 217 GLN GLN A . n A 1 100 TYR 100 218 218 TYR TYR A . n A 1 101 GLN 101 219 219 GLN GLN A . n A 1 102 LYS 102 220 220 LYS LYS A . n A 1 103 GLU 103 221 221 GLU GLU A . n A 1 104 SER 104 222 222 SER SER A . n A 1 105 GLN 105 223 223 GLN GLN A . n A 1 106 ALA 106 224 224 ALA ALA A . n A 1 107 TYR 107 225 225 TYR TYR A . n A 1 108 TYR 108 226 226 TYR TYR A . n A 1 109 ASP 109 227 227 ASP ASP A . n A 1 110 GLY 110 228 228 GLY GLY A . n A 1 111 ARG 111 229 229 ARG ARG A . n A 1 112 ARG 112 230 230 ARG ARG A . n A 1 113 SER 113 231 231 SER SER A . n A 1 114 SER 114 232 232 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-12-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2021-11-10 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' database_2 7 4 'Structure model' struct_ref_seq_dif 8 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_struct_ref_seq_dif.details' 7 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Prion Protein' 0.4 mM '[U-99% 13C; U-99% 15N]' 1 D2O 10 % ? 1 H2O 90 % ? 1 'sodium acetate' 10 mM '[U-2H]' 1 'sodium azide' 0.02 % ? 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HG1 A THR 199 ? ? OD1 A ASP 202 ? ? 1.56 2 2 HH A TYR 149 ? ? OD1 A ASP 202 ? ? 1.60 3 4 HG1 A THR 199 ? ? OD1 A ASP 202 ? ? 1.58 4 8 HH A TYR 169 ? ? OD2 A ASP 178 ? ? 1.57 5 10 HG1 A THR 199 ? ? OD2 A ASP 202 ? ? 1.58 6 13 HH A TYR 149 ? ? OD1 A ASP 202 ? ? 1.59 7 15 HH A TYR 149 ? ? OD1 A ASP 202 ? ? 1.59 8 20 O A THR 192 ? ? HG1 A THR 193 ? ? 1.55 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 CB A TYR 157 ? ? CG A TYR 157 ? ? CD2 A TYR 157 ? ? 117.34 121.00 -3.66 0.60 N 2 6 CB A TYR 157 ? ? CG A TYR 157 ? ? CD2 A TYR 157 ? ? 117.15 121.00 -3.85 0.60 N 3 7 CB A TYR 150 ? ? CG A TYR 150 ? ? CD2 A TYR 150 ? ? 116.84 121.00 -4.16 0.60 N 4 7 CA A CYS 179 ? ? CB A CYS 179 ? ? SG A CYS 179 ? ? 120.93 114.20 6.73 1.10 N 5 9 NE A ARG 136 ? ? CZ A ARG 136 ? ? NH2 A ARG 136 ? ? 117.27 120.30 -3.03 0.50 N 6 9 CA A CYS 179 ? ? CB A CYS 179 ? ? SG A CYS 179 ? ? 121.05 114.20 6.85 1.10 N 7 10 CB A TYR 157 ? ? CG A TYR 157 ? ? CD2 A TYR 157 ? ? 116.77 121.00 -4.23 0.60 N 8 11 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 123.56 120.30 3.26 0.50 N 9 13 CG1 A VAL 215 ? ? CB A VAL 215 ? ? CG2 A VAL 215 ? ? 100.81 110.90 -10.09 1.60 N 10 14 CB A TYR 157 ? ? CG A TYR 157 ? ? CD2 A TYR 157 ? ? 117.09 121.00 -3.91 0.60 N 11 16 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 124.55 120.30 4.25 0.50 N 12 16 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH2 A ARG 156 ? ? 116.78 120.30 -3.52 0.50 N 13 17 CA A VAL 166 ? ? CB A VAL 166 ? ? CG2 A VAL 166 ? ? 120.24 110.90 9.34 1.50 N 14 18 CA A VAL 161 ? ? CB A VAL 161 ? ? CG1 A VAL 161 ? ? 120.72 110.90 9.82 1.50 N 15 18 CA A VAL 209 ? ? CB A VAL 209 ? ? CG2 A VAL 209 ? ? 121.87 110.90 10.97 1.50 N 16 19 CB A TYR 128 ? ? CG A TYR 128 ? ? CD2 A TYR 128 ? ? 116.37 121.00 -4.63 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 170 ? ? -135.02 -62.75 2 1 THR A 192 ? ? -74.33 -155.25 3 1 LYS A 194 ? ? -164.95 19.49 4 1 ARG A 229 ? ? 24.28 11.11 5 1 ARG A 230 ? ? 69.08 116.37 6 2 SER A 132 ? ? 45.54 103.88 7 2 ASN A 170 ? ? -134.18 -69.18 8 2 THR A 192 ? ? -94.41 -140.75 9 2 LYS A 194 ? ? -149.72 -47.01 10 2 ASP A 227 ? ? 49.24 24.03 11 2 ARG A 230 ? ? -64.26 23.95 12 3 VAL A 122 ? ? -125.83 -69.87 13 3 LEU A 125 ? ? 80.28 83.20 14 3 SER A 135 ? ? -67.96 98.86 15 3 ARG A 136 ? ? -39.89 110.48 16 3 THR A 192 ? ? -91.76 -150.47 17 3 THR A 193 ? ? 82.43 3.06 18 3 LYS A 194 ? ? -142.35 -97.76 19 3 ARG A 230 ? ? 62.34 103.35 20 4 VAL A 122 ? ? -130.13 -85.13 21 4 LEU A 125 ? ? -164.31 118.13 22 4 SER A 132 ? ? 58.68 146.83 23 4 ASN A 170 ? ? -131.29 -66.00 24 4 THR A 193 ? ? 179.86 -25.62 25 4 LYS A 194 ? ? -162.48 -8.58 26 4 ASP A 227 ? ? 59.09 -27.06 27 4 ARG A 229 ? ? 24.04 80.49 28 4 SER A 231 ? ? 45.07 73.40 29 5 VAL A 122 ? ? -99.72 -87.33 30 5 LEU A 125 ? ? -152.45 45.94 31 5 THR A 188 ? ? -69.82 5.97 32 5 THR A 193 ? ? 169.79 -26.71 33 5 LYS A 194 ? ? 170.00 43.51 34 5 ASP A 227 ? ? 38.76 27.77 35 5 ARG A 229 ? ? -65.03 7.64 36 6 LEU A 125 ? ? -145.73 13.04 37 6 MET A 138 ? ? -103.71 76.72 38 6 THR A 192 ? ? -76.21 -159.58 39 6 LYS A 194 ? ? -170.75 -81.42 40 6 ASP A 227 ? ? 41.24 15.08 41 7 LEU A 125 ? ? -153.70 45.67 42 7 SER A 135 ? ? -55.31 109.83 43 7 PRO A 137 ? ? -73.15 -168.72 44 7 ASP A 167 ? ? -29.14 -51.24 45 7 ASN A 170 ? ? -135.65 -71.93 46 7 THR A 193 ? ? -151.33 -16.25 47 7 LYS A 194 ? ? -160.49 -57.34 48 7 ASP A 227 ? ? 45.33 -25.54 49 7 ARG A 229 ? ? 23.72 55.73 50 7 SER A 231 ? ? -46.96 109.25 51 8 THR A 193 ? ? 161.93 -26.12 52 8 LYS A 194 ? ? -159.21 -72.09 53 8 GLU A 207 ? ? -65.80 1.07 54 8 ARG A 229 ? ? -63.80 74.01 55 9 VAL A 122 ? ? -122.62 -64.00 56 9 LYS A 185 ? ? -75.29 30.41 57 9 THR A 193 ? ? 163.39 -25.66 58 9 LYS A 194 ? ? -169.82 -35.80 59 9 SER A 231 ? ? -106.19 -161.36 60 10 VAL A 122 ? ? -80.89 -73.57 61 10 ARG A 136 ? ? -64.86 98.16 62 10 ASN A 170 ? ? -119.67 -73.14 63 10 LYS A 185 ? ? -68.26 8.90 64 10 HIS A 187 ? ? -130.87 -45.92 65 10 THR A 193 ? ? 46.47 90.86 66 10 LYS A 194 ? ? 75.03 68.75 67 10 ARG A 230 ? ? -148.05 26.67 68 11 LEU A 125 ? ? -151.95 61.17 69 11 LYS A 194 ? ? -159.60 5.07 70 11 GLU A 207 ? ? -60.72 0.64 71 11 ASP A 227 ? ? 45.66 0.83 72 11 SER A 231 ? ? 80.21 53.63 73 12 THR A 193 ? ? -168.62 -7.69 74 12 LYS A 194 ? ? -171.35 -36.96 75 12 ASP A 227 ? ? 47.78 -56.57 76 13 TYR A 169 ? ? -78.72 -166.58 77 13 ASN A 170 ? ? -143.77 -39.47 78 13 THR A 193 ? ? -143.16 -27.12 79 13 LYS A 194 ? ? -171.15 50.57 80 13 ARG A 230 ? ? -150.18 83.71 81 14 VAL A 122 ? ? -143.39 -76.51 82 14 ASN A 153 ? ? -64.53 2.42 83 14 TYR A 169 ? ? -102.93 -169.11 84 14 THR A 192 ? ? -70.09 -147.20 85 14 THR A 193 ? ? 74.46 61.87 86 14 LYS A 194 ? ? 80.95 -45.26 87 14 ARG A 230 ? ? -65.22 9.37 88 15 LEU A 125 ? ? 95.16 84.47 89 15 TYR A 169 ? ? -123.83 -169.53 90 15 ASN A 170 ? ? -127.54 -69.78 91 15 THR A 192 ? ? -76.27 -159.60 92 15 LYS A 194 ? ? -159.03 -69.72 93 15 ASP A 227 ? ? 57.44 -32.27 94 15 ARG A 230 ? ? 52.83 88.46 95 15 SER A 231 ? ? 71.27 100.29 96 16 VAL A 122 ? ? -89.95 -70.99 97 16 ASN A 170 ? ? -142.10 -11.09 98 16 THR A 193 ? ? 175.65 -24.87 99 16 LYS A 194 ? ? -145.03 -77.32 100 16 SER A 231 ? ? -63.85 -179.98 101 17 VAL A 121 ? ? -120.56 -167.36 102 17 LEU A 125 ? ? -140.10 31.17 103 17 ARG A 136 ? ? -29.96 102.92 104 17 GLN A 168 ? ? -160.11 -32.99 105 17 ASN A 170 ? ? 76.96 -29.42 106 17 PHE A 175 ? ? -70.32 -77.06 107 17 LYS A 185 ? ? -64.00 7.07 108 17 THR A 193 ? ? 75.69 141.23 109 17 ASP A 227 ? ? 44.90 -9.72 110 18 ASN A 170 ? ? -133.76 -67.82 111 18 THR A 191 ? ? -72.05 -78.46 112 18 THR A 193 ? ? -149.89 -25.92 113 18 LYS A 194 ? ? -149.08 -32.89 114 18 ASP A 227 ? ? 42.31 28.04 115 18 SER A 231 ? ? -153.53 -54.56 116 19 LYS A 185 ? ? -67.36 5.13 117 19 GLN A 186 ? ? -93.61 -67.42 118 19 LYS A 194 ? ? 167.63 20.09 119 19 ASP A 227 ? ? 42.36 21.54 120 20 VAL A 121 ? ? 61.86 152.03 121 20 LEU A 125 ? ? 58.56 10.73 122 20 GLN A 186 ? ? -72.76 -76.12 123 20 THR A 193 ? ? 179.37 -26.84 124 20 LYS A 194 ? ? -171.24 -22.38 125 20 ARG A 230 ? ? -153.75 84.84 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ARG A 229 ? ? ARG A 230 ? ? -133.02 2 4 ASP A 227 ? ? GLY A 228 ? ? -147.38 3 7 TYR A 226 ? ? ASP A 227 ? ? -144.11 4 8 SER A 231 ? ? SER A 232 ? ? 145.53 5 9 GLY A 127 ? ? TYR A 128 ? ? 141.53 6 9 SER A 231 ? ? SER A 232 ? ? 147.84 7 10 LEU A 125 ? ? GLY A 126 ? ? 141.56 8 13 ARG A 230 ? ? SER A 231 ? ? 148.25 9 16 LEU A 125 ? ? GLY A 126 ? ? 149.97 10 16 ASN A 143 ? ? ASP A 144 ? ? -149.76 11 17 THR A 192 ? ? THR A 193 ? ? -139.30 12 19 GLY A 131 ? ? SER A 132 ? ? 148.75 13 20 SER A 231 ? ? SER A 232 ? ? -147.02 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 128 ? ? 0.110 'SIDE CHAIN' 2 1 ARG A 148 ? ? 0.103 'SIDE CHAIN' 3 1 TYR A 226 ? ? 0.089 'SIDE CHAIN' 4 2 TYR A 128 ? ? 0.087 'SIDE CHAIN' 5 2 TYR A 162 ? ? 0.086 'SIDE CHAIN' 6 2 TYR A 169 ? ? 0.068 'SIDE CHAIN' 7 2 ARG A 208 ? ? 0.104 'SIDE CHAIN' 8 3 TYR A 150 ? ? 0.095 'SIDE CHAIN' 9 3 ARG A 156 ? ? 0.154 'SIDE CHAIN' 10 4 TYR A 128 ? ? 0.088 'SIDE CHAIN' 11 4 ARG A 148 ? ? 0.147 'SIDE CHAIN' 12 4 TYR A 218 ? ? 0.077 'SIDE CHAIN' 13 4 ARG A 229 ? ? 0.104 'SIDE CHAIN' 14 5 TYR A 128 ? ? 0.078 'SIDE CHAIN' 15 5 TYR A 155 ? ? 0.073 'SIDE CHAIN' 16 6 TYR A 128 ? ? 0.074 'SIDE CHAIN' 17 6 ARG A 151 ? ? 0.191 'SIDE CHAIN' 18 6 TYR A 157 ? ? 0.118 'SIDE CHAIN' 19 6 TYR A 163 ? ? 0.069 'SIDE CHAIN' 20 7 ARG A 208 ? ? 0.125 'SIDE CHAIN' 21 7 TYR A 226 ? ? 0.068 'SIDE CHAIN' 22 8 TYR A 157 ? ? 0.081 'SIDE CHAIN' 23 9 TYR A 128 ? ? 0.089 'SIDE CHAIN' 24 9 TYR A 157 ? ? 0.072 'SIDE CHAIN' 25 9 ARG A 164 ? ? 0.134 'SIDE CHAIN' 26 9 TYR A 169 ? ? 0.076 'SIDE CHAIN' 27 11 ARG A 164 ? ? 0.083 'SIDE CHAIN' 28 11 ARG A 230 ? ? 0.077 'SIDE CHAIN' 29 13 TYR A 128 ? ? 0.067 'SIDE CHAIN' 30 13 TYR A 157 ? ? 0.068 'SIDE CHAIN' 31 13 TYR A 162 ? ? 0.075 'SIDE CHAIN' 32 14 HIS A 187 ? ? 0.092 'SIDE CHAIN' 33 15 TYR A 157 ? ? 0.096 'SIDE CHAIN' 34 16 TYR A 150 ? ? 0.071 'SIDE CHAIN' 35 16 TYR A 157 ? ? 0.102 'SIDE CHAIN' 36 17 TYR A 128 ? ? 0.098 'SIDE CHAIN' 37 17 ARG A 164 ? ? 0.145 'SIDE CHAIN' 38 17 TYR A 169 ? ? 0.065 'SIDE CHAIN' 39 17 HIS A 187 ? ? 0.115 'SIDE CHAIN' 40 17 PHE A 198 ? ? 0.098 'SIDE CHAIN' 41 18 ARG A 151 ? ? 0.088 'SIDE CHAIN' 42 19 TYR A 128 ? ? 0.103 'SIDE CHAIN' 43 19 ARG A 230 ? ? 0.116 'SIDE CHAIN' 44 20 TYR A 128 ? ? 0.110 'SIDE CHAIN' 45 20 ARG A 151 ? ? 0.138 'SIDE CHAIN' 46 20 TYR A 163 ? ? 0.069 'SIDE CHAIN' 47 20 TYR A 225 ? ? 0.071 'SIDE CHAIN' 48 20 ARG A 229 ? ? 0.074 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 119 ? A GLY 1 2 2 Y 1 A GLY 119 ? A GLY 1 3 3 Y 1 A GLY 119 ? A GLY 1 4 4 Y 1 A GLY 119 ? A GLY 1 5 5 Y 1 A GLY 119 ? A GLY 1 6 6 Y 1 A GLY 119 ? A GLY 1 7 7 Y 1 A GLY 119 ? A GLY 1 8 8 Y 1 A GLY 119 ? A GLY 1 9 9 Y 1 A GLY 119 ? A GLY 1 10 10 Y 1 A GLY 119 ? A GLY 1 11 11 Y 1 A GLY 119 ? A GLY 1 12 12 Y 1 A GLY 119 ? A GLY 1 13 13 Y 1 A GLY 119 ? A GLY 1 14 14 Y 1 A GLY 119 ? A GLY 1 15 15 Y 1 A GLY 119 ? A GLY 1 16 16 Y 1 A GLY 119 ? A GLY 1 17 17 Y 1 A GLY 119 ? A GLY 1 18 18 Y 1 A GLY 119 ? A GLY 1 19 19 Y 1 A GLY 119 ? A GLY 1 20 20 Y 1 A GLY 119 ? A GLY 1 #